1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His)

Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His)

Cat. No.: HY-P73712
Handling Instructions Technical Support

Peroxiredoxin-2/PRDX2 protein is a thiol-specific peroxidase that effectively reduces hydrogen peroxide and organic hydroperoxides, protecting cells from oxidative stress and maintaining redox homeostasis. It also acts as a sensor for hydrogen peroxide-mediated signaling, regulating cellular responses to oxidative stress. Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His) is the recombinant mouse-derived Peroxiredoxin-2/PRDX2 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Peroxiredoxin-2/PRDX2 protein is a thiol-specific peroxidase that effectively reduces hydrogen peroxide and organic hydroperoxides, protecting cells from oxidative stress and maintaining redox homeostasis. It also acts as a sensor for hydrogen peroxide-mediated signaling, regulating cellular responses to oxidative stress. Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His) is the recombinant mouse-derived Peroxiredoxin-2/PRDX2 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

Peroxiredoxin-2/PRDX2 Protein functions as a thiol-specific peroxidase, adept at catalyzing the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. This protein assumes a crucial role in cellular protection against oxidative stress by efficiently detoxifying various peroxides, contributing significantly to the maintenance of cellular redox homeostasis. Additionally, PRDX2 acts as a sensor for hydrogen peroxide-mediated signaling events, implicating its involvement in modulating cellular responses to oxidative stress. Furthermore, it may participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating intracellular concentrations of H(2)O(2), suggesting its potential impact on signaling pathways associated with cellular growth and inflammation.

Species

Mouse

Source

Sf9 insect cells

Tag

N-His

Accession

Q61171/NP_035693.3 (M1-N198)

Gene ID
Molecular Construction
N-term
His
Peroxiredoxin-2/PRDX2 (M1-N198)
Accession # Q61171/NP_035693.3
C-term
Protein Length

Full Length

Synonyms
Peroxiredoxin-2; NKEF-B; TSA; PRDX2; TDPX1
AA Sequence

MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Predicted Molecular Mass
24.1 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His)
Cat. No.:
HY-P73712
Quantity:
MCE Japan Authorized Agent: