Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His)
Peroxiredoxin-2/PRDX2 protein is a thiol-specific peroxidase that effectively reduces hydrogen peroxide and organic hydroperoxides, protecting cells from oxidative stress and maintaining redox homeostasis. It also acts as a sensor for hydrogen peroxide-mediated signaling, regulating cellular responses to oxidative stress. Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His) is the recombinant mouse-derived Peroxiredoxin-2/PRDX2 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Peroxiredoxin-2/PRDX2 protein is a thiol-specific peroxidase that effectively reduces hydrogen peroxide and organic hydroperoxides, protecting cells from oxidative stress and maintaining redox homeostasis. It also acts as a sensor for hydrogen peroxide-mediated signaling, regulating cellular responses to oxidative stress. Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His) is the recombinant mouse-derived Peroxiredoxin-2/PRDX2 protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
Peroxiredoxin-2/PRDX2 Protein functions as a thiol-specific peroxidase, adept at catalyzing the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. This protein assumes a crucial role in cellular protection against oxidative stress by efficiently detoxifying various peroxides, contributing significantly to the maintenance of cellular redox homeostasis. Additionally, PRDX2 acts as a sensor for hydrogen peroxide-mediated signaling events, implicating its involvement in modulating cellular responses to oxidative stress. Furthermore, it may participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating intracellular concentrations of H(2)O(2), suggesting its potential impact on signaling pathways associated with cellular growth and inflammation.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
Q61171/NP_035693.3 (M1-N198)
-
Molecular Construction
-
N-term
-
His
-
Peroxiredoxin-2/PRDX2 (M1-N198)
Accession # Q61171/NP_035693.3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PRDX2; Natural Killer Cell-Enhancing Factor B; Prev. TDPX1; MGC4104; NKEFB; NKEF-B; PRP; Torin; TSA; Epididymis Secretory Sperm Binding Protein Li 2a; Thioredoxin-Dependent Peroxide Reductase 1; Thiol-Specific Antioxidant Protein; Thioredoxin-Dependent Pe
-
AA Sequence
MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
-
Predicted Molecular Mass
24.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
