1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His)

Peroxiredoxin-2/PRDX2 protein is a thiol-specific peroxidase that effectively reduces hydrogen peroxide and organic hydroperoxides, protecting cells from oxidative stress and maintaining redox homeostasis. It also acts as a sensor for hydrogen peroxide-mediated signaling, regulating cellular responses to oxidative stress. Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His) is the recombinant mouse-derived Peroxiredoxin-2/PRDX2 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

Peroxiredoxin-2/PRDX2 protein is a thiol-specific peroxidase that effectively reduces hydrogen peroxide and organic hydroperoxides, protecting cells from oxidative stress and maintaining redox homeostasis. It also acts as a sensor for hydrogen peroxide-mediated signaling, regulating cellular responses to oxidative stress. Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His) is the recombinant mouse-derived Peroxiredoxin-2/PRDX2 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

Peroxiredoxin-2/PRDX2 Protein functions as a thiol-specific peroxidase, adept at catalyzing the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. This protein assumes a crucial role in cellular protection against oxidative stress by efficiently detoxifying various peroxides, contributing significantly to the maintenance of cellular redox homeostasis. Additionally, PRDX2 acts as a sensor for hydrogen peroxide-mediated signaling events, implicating its involvement in modulating cellular responses to oxidative stress. Furthermore, it may participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating intracellular concentrations of H(2)O(2), suggesting its potential impact on signaling pathways associated with cellular growth and inflammation.

Species

Mouse

Source

Sf9 insect cells

Tag

N-His

Accession

Q61171/NP_035693.3 (M1-N198)

Gene ID
Molecular Construction
N-term
His
Peroxiredoxin-2/PRDX2 (M1-N198)
Accession # Q61171/NP_035693.3
C-term
Protein Length

Full Length

Synonyms
Peroxiredoxin-2; NKEF-B; TSA; PRDX2; TDPX1
AA Sequence

MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Predicted Molecular Mass
24.1 kDa
Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación

Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Peroxiredoxin-2/PRDX2 Protein, Mouse (sf9, His)
Cat. No.:
HY-P73712
Cantidad:
MCE Japan Authorized Agent: