Copy Link Print Information

PGAM1 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

PGAM1 protein plays a pivotal role in glycolysis by catalyzing the vital interconversion of 2-phosphoglycerate and 3-phosphoglycerate. Additionally, it is instrumental in the conversion of (2R)-2,3-bisphosphoglycerate to (2R)-3-phospho-glyceroyl phosphate, further contributing to the intricate metabolic processes associated with glycolytic pathways. PGAM1 Protein, Human is the recombinant human-derived PGAM1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • PGAM1 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PGAM1 protein plays a pivotal role in glycolysis by catalyzing the vital interconversion of 2-phosphoglycerate and 3-phosphoglycerate. Additionally, it is instrumental in the conversion of (2R)-2,3-bisphosphoglycerate to (2R)-3-phospho-glyceroyl phosphate, further contributing to the intricate metabolic processes associated with glycolytic pathways. PGAM1 Protein, Human is the recombinant human-derived PGAM1 protein, expressed by E. coli , with tag free.

Background

PGAM1, or phosphoglycerate mutase 1, plays a pivotal role in glycolysis by catalyzing the reversible interconversion of 2-phosphoglycerate and 3-phosphoglycerate. This enzymatic activity is a crucial step in the glycolytic pathway, facilitating the conversion of glucose-derived substrates into energy and metabolic intermediates. Additionally, PGAM1 is involved in the interconversion of (2R)-2,3-bisphosphoglycerate and (2R)-3-phospho-glyceroyl phosphate. The regulation of these reactions is vital for maintaining the glycolytic flux and ensuring the proper flow of metabolites through the glycolytic pathway. PGAM1's enzymatic functions contribute to the overall efficiency of energy production and metabolic homeostasis within cells.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P18669 (M1-K254)

  • Gene ID
    5223
  • Molecular Construction
    • N-term
    • PGAM1 (M1-K254)
      Accession # P18669
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PGAM1; Phosphoglycerate mutase 1; BPG-dependent PGAM 1; Phosphoglycerate mutase isozyme B; PGAM-B

  • AA Sequence

    MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK

  • Predicted Molecular Mass

    28.9 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 1 mM DTT, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PGAM1 Protein, Human Product Image
    1/16
  • PGAM1 Protein, Human Product Image