PGAM1 Protein, Human
Based on 1 publication(s) in Google Scholar
PGAM1 protein plays a pivotal role in glycolysis by catalyzing the vital interconversion of 2-phosphoglycerate and 3-phosphoglycerate. Additionally, it is instrumental in the conversion of (2R)-2,3-bisphosphoglycerate to (2R)-3-phospho-glyceroyl phosphate, further contributing to the intricate metabolic processes associated with glycolytic pathways. PGAM1 Protein, Human is the recombinant human-derived PGAM1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PGAM1 protein plays a pivotal role in glycolysis by catalyzing the vital interconversion of 2-phosphoglycerate and 3-phosphoglycerate. Additionally, it is instrumental in the conversion of (2R)-2,3-bisphosphoglycerate to (2R)-3-phospho-glyceroyl phosphate, further contributing to the intricate metabolic processes associated with glycolytic pathways. PGAM1 Protein, Human is the recombinant human-derived PGAM1 protein, expressed by E. coli , with tag free.
Background
PGAM1, or phosphoglycerate mutase 1, plays a pivotal role in glycolysis by catalyzing the reversible interconversion of 2-phosphoglycerate and 3-phosphoglycerate. This enzymatic activity is a crucial step in the glycolytic pathway, facilitating the conversion of glucose-derived substrates into energy and metabolic intermediates. Additionally, PGAM1 is involved in the interconversion of (2R)-2,3-bisphosphoglycerate and (2R)-3-phospho-glyceroyl phosphate. The regulation of these reactions is vital for maintaining the glycolytic flux and ensuring the proper flow of metabolites through the glycolytic pathway. PGAM1's enzymatic functions contribute to the overall efficiency of energy production and metabolic homeostasis within cells.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Rep Med
Bacterial vesicles from intratumoral L. salivarius enhance PD-1 blockade via FPR1-mediated macrophage polarization in gastric cancer. [Abstract]2026 Feb 17;7(2):102621. PMID: 41707647
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P18669 (M1-K254)
-
Gene ID5223
-
Molecular Construction
-
N-term
-
PGAM1 (M1-K254)
Accession # P18669 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PGAM1; Phosphoglycerate Mutase Isozyme B; Prev. PGAMA; HEL-S-35; PGAM-B; Epididymis Secretory Protein Li 35; Phosphoglycerate Mutase A, Nonmuscle Form; Phosphoglycerate Mutase; Phosphoglycerate Mutase 1 (Brain); Phosphoglycerate Mutase 1; BPG-Dependent PG
-
AA Sequence
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
-
Predicted Molecular Mass
28.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 1 mM DTT, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)