PHPT1 Protein, Human (His)
Based on 1 Customer Validation
The PHPT1 protein acts as a phosphohistidine phosphatase, catalyzing the dephosphorylation of phosphohistidine residues. This unique enzymatic activity makes PHPT1 a regulator of histidine phosphorylation events, suggesting that it is involved in signaling pathways or cellular processes that are critical for phosphohistidine modification. PHPT1 Protein, Human (His) is the recombinant human-derived PHPT1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PHPT1 protein acts as a phosphohistidine phosphatase, catalyzing the dephosphorylation of phosphohistidine residues. This unique enzymatic activity makes PHPT1 a regulator of histidine phosphorylation events, suggesting that it is involved in signaling pathways or cellular processes that are critical for phosphohistidine modification. PHPT1 Protein, Human (His) is the recombinant human-derived PHPT1 protein, expressed by E. coli , with N-His labeled tag.
PHPT1 protein serves as a phosphohistidine phosphatase, showcasing its specific enzymatic activity in catalyzing the dephosphorylation of phosphohistidine residues. This unique biochemical function positions PHPT1 as a regulator of histidine phosphorylation events, suggesting its involvement in signaling pathways or cellular processes where phosphohistidine modification plays a crucial role. The enzymatic capability of PHPT1 underscores its potential significance in modulating histidine phosphorylation dynamics and highlights its contribution to cellular regulatory mechanisms.
Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 43.24 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9NRX4-1 (A2-Y125)
-
Molecular Construction
-
N-term
-
His
-
PHPT1 (A2-Y125)
Accession # Q9NRX4-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
PHPT1; Protein Janus-A Homolog; Phosphohistidine Phosphatase 1; DKFZp564M173; PHP14; BA216L13.10; 14 KDa Phosphohistidine Phosphatase; PHP; Protein Histidine Phosphatase; Epididymis Secretory Sperm Binding Protein Li 132P; HSPC141; Phosphohistidine Phosph
-
AA Sequence
AVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
-
Predicted Molecular Mass
15.2 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
