PIP/GCDFP-15 Protein, Human (His)
PIP/GCDFP-15 protein, as a monomer, interacts with AZGP1. PIP/GCDFP-15 Protein, Human (His) is the recombinant human-derived PIP/GCDFP-15 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PIP/GCDFP-15 protein, as a monomer, interacts with AZGP1. PIP/GCDFP-15 Protein, Human (His) is the recombinant human-derived PIP/GCDFP-15 protein, expressed by E. coli , with N-6*His labeled tag.
Background
PIP/GCDFP-15 protein, existing as a monomer, interacts with AZGP1.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P12273 (Q29-E146)
-
Molecular Construction
-
N-term
-
6*His
-
PIP (Q29-E146)
Accession # P12273 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PIP; Secretory Actin-Binding Protein; Prolactin Induced Protein; Prolactin-Inducible Protein; GCDFP-15; BRST-2; GCDFP15; Prolactin-Induced Protein; GPIP4; Apocrine; SABP; Gp17; Gross Cystic Disease Fluid Protein 15
-
AA Sequence
QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
-
Predicted Molecular Mass
17.5 kDa
-
Purity
≥ 90%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
