PIST Protein, Human (His)
Based on 1 Customer Validation
PIST (PDZ domain-containing protein that interacts with Stx6) is critical in intracellular protein trafficking and degradation. It modulates CFTR chloride currents and acid-induced ASIC3 currents, thereby potentially regulating their cell surface expression. PIST Protein, Human (His) is the recombinant human-derived PIST protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PIST (PDZ domain-containing protein that interacts with Stx6) is critical in intracellular protein trafficking and degradation. It modulates CFTR chloride currents and acid-induced ASIC3 currents, thereby potentially regulating their cell surface expression. PIST Protein, Human (His) is the recombinant human-derived PIST protein, expressed by E. coli , with N-His labeled tag.
PIST (PDZ domain-containing protein that interacts with Stx6) plays a crucial role in intracellular protein trafficking and degradation, as evidenced by its involvement in diverse cellular processes. It is implicated in the regulation of CFTR chloride currents and acid-induced ASIC3 currents, potentially modulating the cell surface expression of both channels. Moreover, PIST is associated with the intracellular trafficking of the ADR1B receptor and may contribute to autophagy regulation. In collaboration with MARCHF2, PIST mediates the ubiquitination and lysosomal degradation of CFTR, leading to its intracellular retention and subsequent lysosomal degradation. The protein forms homooligomers and engages in a network of interactions with various partners, including FZD5, FZD8, GRID2, BECN1, CSPG5, CLCN3, STX6, CFTR, ASIC3, GOLGA3, NLGN1, RHOQ, MARCHF2, ADRB1, and potentially CACNG2 and CCDC62, highlighting its multifaceted roles in cellular trafficking and signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9HD26-1 (I286-Y462)
-
Molecular Construction
-
N-term
-
His
-
PIST (I286-Y462)
Accession # Q9HD26-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
GOPC; PDZ Protein Interacting Specifically With TC10; Golgi Associated PDZ And Coiled-Coil Motif Containing; CFTR-Associated Ligand; PIST; Fused In Glioblastoma; FIG; Golgi-Associated PDZ And Coiled-Coil Motif Containing Protein Transcript Variant 4; CAL;
-
AA Sequence
IRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQGFNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
-
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
