PKA/PRKACA Protein, Human (Active, sf9, GST)
Based on 1 Customer Validation
PKACα protein is a key kinase that phosphorylates a variety of substrates, including CDC25B, ABL1, NFKB1, and VASP, affecting a variety of cellular processes, such as cell cycle progression, platelet regulation, and adipogenic differentiation. It also negatively regulates mTORC1 through RPTOR phosphorylation, thereby modulating signaling networks. PKA/PRKACA Protein, Human (sf9, GST) is the recombinant human-derived PKACα protein, expressed by sf9 insect cells , with GST tagged.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PKACα protein is a key kinase that phosphorylates a variety of substrates, including CDC25B, ABL1, NFKB1, and VASP, affecting a variety of cellular processes, such as cell cycle progression, platelet regulation, and adipogenic differentiation. It also negatively regulates mTORC1 through RPTOR phosphorylation, thereby modulating signaling networks. PKA/PRKACA Protein, Human (sf9, GST) is the recombinant human-derived PKACα protein, expressed by sf9 insect cells , with GST tagged.
Background
PKACα, a protein kinase, plays a pivotal role in cellular regulation by phosphorylating a myriad of substrates in both the cytoplasm and the nucleus. Its extensive substrate repertoire includes CDC25B, ABL1, NFKB1, CLDN3, PSMC5/RPT6, PJA2, RYR2, RORA, SOX9, and VASP, among others. Through the phosphorylation of specific substrates, PKACα influences diverse cellular processes such as cell cycle progression, platelet regulation, adipogenic and osteogenic differentiation, chondrogenesis, and tight junction dynamics. Notably, PKACα negatively regulates mTORC1 by phosphorylating RPTOR, acting as a key modulator in the intricate signaling network. Additionally, PKACα exerts regulatory effects on embryonic development, Hedgehog signaling, meiosis resumption, and even REM sleep, showcasing its multifaceted roles in cellular physiology and homeostasis.
Verified Bioactivity
The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 0.05 nM, the conversion rate is about 20%.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag GST
-
Accession
P17612-1 (G2-F351)
-
Gene ID5566
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PRKACA; CDNA FLJ58698, Highly Similar To CAMP-Dependent Protein Kinase, Alpha-Catalytic Subunit; Protein Kinase CAMP-Activated Catalytic Subunit Alpha; Protein Kinase A Catalytic Subunit; CAMP-Dependent Protein Kinase Catalytic Subunit Alpha; Protein Kinase A-Alpha; PKA C-Alpha; PPNAD4; PKACa; CAFD1; Protein Kinase, CAMP-Dependent, Alpha Catalytic Subunit; PKACA; Protein Kinase, CAMP-Dependent, Catalytic, Alpha; KIN27
-
AA Sequence
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
-
Molecular Weight
Approximately 67 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 20% glycerol, 5 mM DTT, 0.1 M Trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
