PKA/PRKACA Protein, Human (Active, sf9, GST)

PKACα protein is a key kinase that phosphorylates a variety of substrates, including CDC25B, ABL1, NFKB1, and VASP, affecting a variety of cellular processes, such as cell cycle progression, platelet regulation, and adipogenic differentiation. It also negatively regulates mTORC1 through RPTOR phosphorylation, thereby modulating signaling networks. PKA/PRKACA Protein, Human (sf9, GST) is the recombinant human-derived PKACα protein, expressed by sf9 insect cells , with GST tagged.

PKACα, a protein kinase, plays a pivotal role in cellular regulation by phosphorylating a myriad of substrates in both the cytoplasm and the nucleus. Its extensive substrate repertoire includes CDC25B, ABL1, NFKB1, CLDN3, PSMC5/RPT6, PJA2, RYR2, RORA, SOX9, and VASP, among others. Through the phosphorylation of specific substrates, PKACα influences diverse cellular processes such as cell cycle progression, platelet regulation, adipogenic and osteogenic differentiation, chondrogenesis, and tight junction dynamics. Notably, PKACα negatively regulates mTORC1 by phosphorylating RPTOR, acting as a key modulator in the intricate signaling network. Additionally, PKACα exerts regulatory effects on embryonic development, Hedgehog signaling, meiosis resumption, and even REM sleep, showcasing its multifaceted roles in cellular physiology and homeostasis.

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 0.05 nM, the conversion rate is about 20%.

Human

Sf9 insect cells

GST

P17612 (G2-F351)

5566

Full Length of Mature Protein

GNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

Approximately 67 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 20% glycerol, 5 mM DTT, 0.1 M Trehalose.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.