PKCi Protein, Human (H114A)

PKCi protein has adenosine 5'-monophosphate amidase activity and can hydrolyze compounds such as AMP-NH2. It also acts on AMP-morpholidate, GMP-morpholidate, lysyl-AMP, Met-AMP, His-AMP, Asp-AMP, lysyl-GMP and AMP-N-alanine methyl ester. PKCi Protein, Human (H114A) is the recombinant human-derived PKCi protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PKCi protein has adenosine 5'-monophosphate amidase activity and can hydrolyze compounds such as AMP-NH2. It also acts on AMP-morpholidate, GMP-morpholidate, lysyl-AMP, Met-AMP, His-AMP, Asp-AMP, lysyl-GMP and AMP-N-alanine methyl ester. PKCi Protein, Human (H114A) is the recombinant human-derived PKCi protein, expressed by E. coli , with tag free.

Background

PKCi protein displays versatile enzymatic activities, functioning as an adenosine 5'-monophosphoramidase capable of hydrolyzing purine nucleotide phosphoramidates, such as adenosine 5'-monophosphoramidate (AMP-NH2), to generate AMP and NH2. It also exhibits hydrolytic activity towards adenosine 5'-monophosphomorpholidate (AMP-morpholidate), guanosine 5'-monophosphomorpholidate (GMP-morpholidate), lysyl-AMP, Met-AMP, His-AMP, Asp-AMP, lysyl-GMP, and AMP-N-alanine methyl ester. Moreover, PKCi participates in the conversion of adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates, releasing hydrogen sulfide in the process. Beyond its enzymatic functions, PKCi serves as a scaffolding protein, modulating transcriptional activation by the LEF1/TCF1-CTNNB1 complex and the MITF-CTNNB1 complex. Additionally, it influences p53/TP53 levels, p53/TP53-mediated apoptosis, and regulates the proteasomal degradation of target proteins through the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex. Furthermore, PKCi exhibits SUMO-specific isopeptidase activity, deconjugating SUMO1 from RGS17 and RANGAP1. This multifaceted functionality underscores the diverse roles of PKCi in various cellular processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PKCi (M1-G126, H114A)
      Accession # P49773
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    HINT1; Desumoylating Isopeptidase HINT1; Prev. PRKCNH1; Histidine Triad Nucleotide-Binding Protein 1; Prev. HINT; Histidine Triad Nucleotide-Binding Protein; PKCI-1; Adenosine 5'-Monophosphoramidase; Epididymis Secretory Sperm Binding Protein; PKCI1; Prot

  • AA Sequence

    MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLAVLGGRQMHWPPG

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00