1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PKCi Protein, Human (H114A)

PKCi protein has adenosine 5'-monophosphate amidase activity and can hydrolyze compounds such as AMP-NH2. It also acts on AMP-morpholidate, GMP-morpholidate, lysyl-AMP, Met-AMP, His-AMP, Asp-AMP, lysyl-GMP and AMP-N-alanine methyl ester. PKCi Protein, Human (H114A) is the recombinant human-derived PKCi protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PKCi protein has adenosine 5'-monophosphate amidase activity and can hydrolyze compounds such as AMP-NH2. It also acts on AMP-morpholidate, GMP-morpholidate, lysyl-AMP, Met-AMP, His-AMP, Asp-AMP, lysyl-GMP and AMP-N-alanine methyl ester. PKCi Protein, Human (H114A) is the recombinant human-derived PKCi protein, expressed by E. coli , with tag free.

Background

PKCi protein displays versatile enzymatic activities, functioning as an adenosine 5'-monophosphoramidase capable of hydrolyzing purine nucleotide phosphoramidates, such as adenosine 5'-monophosphoramidate (AMP-NH2), to generate AMP and NH2. It also exhibits hydrolytic activity towards adenosine 5'-monophosphomorpholidate (AMP-morpholidate), guanosine 5'-monophosphomorpholidate (GMP-morpholidate), lysyl-AMP, Met-AMP, His-AMP, Asp-AMP, lysyl-GMP, and AMP-N-alanine methyl ester. Moreover, PKCi participates in the conversion of adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates, releasing hydrogen sulfide in the process. Beyond its enzymatic functions, PKCi serves as a scaffolding protein, modulating transcriptional activation by the LEF1/TCF1-CTNNB1 complex and the MITF-CTNNB1 complex. Additionally, it influences p53/TP53 levels, p53/TP53-mediated apoptosis, and regulates the proteasomal degradation of target proteins through the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex. Furthermore, PKCi exhibits SUMO-specific isopeptidase activity, deconjugating SUMO1 from RGS17 and RANGAP1. This multifaceted functionality underscores the diverse roles of PKCi in various cellular processes.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P49773 (M1-G126, H114A)

Gene ID

3094

Molecular Construction
N-term
PKCi (M1-G126, H114A)
Accession # P49773
C-term
Protein Length

Full Length

Synonyms
HINT1; Adenosine 5'-monophosphoramidase HINT1; Desumoylating isopeptidase HINT1; Histidine triad nucleotide-binding protein 1; Protein kinase C inhibitor 1; Protein kinase C-interacting protein 1; PKCI-1
AA Sequence

MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLAVLGGRQMHWPPG

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

PKCi Protein, Human (H114A) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PKCi Protein, Human (H114A)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PKCi Protein, Human (H114A)
Cat. No.:
HY-P701966
Quantity:
MCE Japan Authorized Agent: