PKCi Protein, Human (H114A)
PKCi protein has adenosine 5'-monophosphate amidase activity and can hydrolyze compounds such as AMP-NH2. It also acts on AMP-morpholidate, GMP-morpholidate, lysyl-AMP, Met-AMP, His-AMP, Asp-AMP, lysyl-GMP and AMP-N-alanine methyl ester. PKCi Protein, Human (H114A) is the recombinant human-derived PKCi protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PKCi protein has adenosine 5'-monophosphate amidase activity and can hydrolyze compounds such as AMP-NH2. It also acts on AMP-morpholidate, GMP-morpholidate, lysyl-AMP, Met-AMP, His-AMP, Asp-AMP, lysyl-GMP and AMP-N-alanine methyl ester. PKCi Protein, Human (H114A) is the recombinant human-derived PKCi protein, expressed by E. coli , with tag free.
Background
PKCi protein displays versatile enzymatic activities, functioning as an adenosine 5'-monophosphoramidase capable of hydrolyzing purine nucleotide phosphoramidates, such as adenosine 5'-monophosphoramidate (AMP-NH2), to generate AMP and NH2. It also exhibits hydrolytic activity towards adenosine 5'-monophosphomorpholidate (AMP-morpholidate), guanosine 5'-monophosphomorpholidate (GMP-morpholidate), lysyl-AMP, Met-AMP, His-AMP, Asp-AMP, lysyl-GMP, and AMP-N-alanine methyl ester. Moreover, PKCi participates in the conversion of adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates, releasing hydrogen sulfide in the process. Beyond its enzymatic functions, PKCi serves as a scaffolding protein, modulating transcriptional activation by the LEF1/TCF1-CTNNB1 complex and the MITF-CTNNB1 complex. Additionally, it influences p53/TP53 levels, p53/TP53-mediated apoptosis, and regulates the proteasomal degradation of target proteins through the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex. Furthermore, PKCi exhibits SUMO-specific isopeptidase activity, deconjugating SUMO1 from RGS17 and RANGAP1. This multifaceted functionality underscores the diverse roles of PKCi in various cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P49773 (M1-G126, H114A)
-
Gene ID3094
-
Molecular Construction
-
N-term
-
PKCi (M1-G126, H114A)
Accession # P49773 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
HINT1; Desumoylating Isopeptidase HINT1; Prev. PRKCNH1; Histidine Triad Nucleotide-Binding Protein 1; Prev. HINT; Histidine Triad Nucleotide-Binding Protein; PKCI-1; Adenosine 5'-Monophosphoramidase; Epididymis Secretory Sperm Binding Protein; PKCI1; Prot
-
AA Sequence
MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLAVLGGRQMHWPPG
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)