PKCz Protein, Human (Active, sf9, GST)

Customer Review

Based on 1 Customer Validation

PKCz proteins are involved in multiple cellular processes, including mitotic signaling, cell proliferation, cell polarity, inflammatory responses, and maintenance of long-term potentiation (LTP). PKCz Protein, Human (sf9) is the recombinant human-derived PKCz protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PKCz proteins are involved in multiple cellular processes, including mitotic signaling, cell proliferation, cell polarity, inflammatory responses, and maintenance of long-term potentiation (LTP). PKCz Protein, Human (sf9) is the recombinant human-derived PKCz protein, expressed by sf9 insect cells , with tag free.

Background

PKCz, a calcium- and diacylglycerol-independent serine/threonine-protein kinase, plays a multifaceted role in cellular processes, acting within the phosphatidylinositol 3-kinase (PI3K) pathway and mitogen-activated protein (MAP) kinase cascade. Involved in diverse functions such as NF-kappa-B activation, mitogenic signaling, cell proliferation, cell polarity, inflammatory response, and the maintenance of long-term potentiation (LTP), PKCz exhibits versatility in its cellular functions. In various contexts, it functions downstream of PI3K, independently activating the MAP2K1/MEK1-MAPK1/ERK2 signaling cascade, contributing to insulin-dependent activation of AKT3, and participating in the transactivation of NF-kappa-B. Additionally, PKCz plays a role in the establishment of cell polarity, stimulates neuronal differentiation, and is implicated in the development of allergic airway inflammation (asthma) through its involvement in Th2 immune response. Furthermore, PKCz is crucial in the late synaptic long-term potentiation phase in CA1 hippocampal cells and is associated with long-term memory maintenance.

Verified Bioactivity

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • PKCz (P2-V592)
      Accession # Q05513-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PRKCZ; NPKC-Zeta; Protein Kinase C Zeta; Non-Specific Serine/Threonine Protein Kinase; PKC2; Protein Kinase C, Zeta; Protein Kinase C Zeta Type; PKC-ZETA

  • AA Sequence

    PSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV

  • Predicted Molecular Mass

    94.2 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00