1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins AGC
  4. PKC
  5. PRKCZ/PKC zeta
  6. PKCz Protein, Human (Active, sf9, GST)

PKCz proteins are involved in multiple cellular processes, including mitotic signaling, cell proliferation, cell polarity, inflammatory responses, and maintenance of long-term potentiation (LTP). PKCz Protein, Human (sf9) is the recombinant human-derived PKCz protein, expressed by sf9 insect cells , with tag free.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
20 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

PKCz proteins are involved in multiple cellular processes, including mitotic signaling, cell proliferation, cell polarity, inflammatory responses, and maintenance of long-term potentiation (LTP). PKCz Protein, Human (sf9) is the recombinant human-derived PKCz protein, expressed by sf9 insect cells , with tag free.

Background

PKCz, a calcium- and diacylglycerol-independent serine/threonine-protein kinase, plays a multifaceted role in cellular processes, acting within the phosphatidylinositol 3-kinase (PI3K) pathway and mitogen-activated protein (MAP) kinase cascade. Involved in diverse functions such as NF-kappa-B activation, mitogenic signaling, cell proliferation, cell polarity, inflammatory response, and the maintenance of long-term potentiation (LTP), PKCz exhibits versatility in its cellular functions. In various contexts, it functions downstream of PI3K, independently activating the MAP2K1/MEK1-MAPK1/ERK2 signaling cascade, contributing to insulin-dependent activation of AKT3, and participating in the transactivation of NF-kappa-B. Additionally, PKCz plays a role in the establishment of cell polarity, stimulates neuronal differentiation, and is implicated in the development of allergic airway inflammation (asthma) through its involvement in Th2 immune response. Furthermore, PKCz is crucial in the late synaptic long-term potentiation phase in CA1 hippocampal cells and is associated with long-term memory maintenance.

Actividad biológica

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device.

Species

Human

Source

Sf9 insect cells

Tag

N-GST

Accession

Q05513-1 (P2-V592)

Gene ID

5590

Molecular Construction
N-term
GST
PKCz (P2-V592)
Accession # Q05513-1
C-term
Protein Length

Partial

Synonyms
PRKCZ; Protein kinase C zeta type; nPKC-zeta
AA Sequence

PSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV

Peso molecular

94.2 KDa

Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

PKCz Protein, Human (Active, sf9, GST)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
PKCz Protein, Human (Active, sf9, GST)
Cat. No.:
HY-P701754
Cantidad:
MCE Japan Authorized Agent: