PKI-beta Protein, Human (His)
Based on 1 Customer Validation
The PKI-β protein emerged as an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity. This protein operates at the molecular level, binding to the catalytic subunit of the enzyme after cAMP induces dissociation of its regulatory chain. PKI-beta Protein, Human (His) is the recombinant human-derived PKI-beta protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PKI-β protein emerged as an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity. This protein operates at the molecular level, binding to the catalytic subunit of the enzyme after cAMP induces dissociation of its regulatory chain. PKI-beta Protein, Human (His) is the recombinant human-derived PKI-beta protein, expressed by E. coli , with N-6*His labeled tag.
The PKI-beta protein is an exceptionally potent competitive inhibitor of cAMP-dependent protein kinase activity. Functioning as a regulatory molecule, PKI-beta exerts its inhibitory action by interacting with the catalytic subunit of the enzyme, particularly after the cAMP-induced dissociation of its regulatory chains. This regulatory mechanism underscores the dynamic nature of cAMP-dependent protein kinase activity and the pivotal role of PKI-beta in modulating this signaling pathway. By tightly regulating the catalytic subunit, PKI-beta plays a crucial role in modulating cellular responses to cAMP signaling, contributing to the fine-tuning of intracellular processes influenced by this important kinase, such as those related to cell growth, metabolism, and gene expression.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9C010-1 (M1-K78)
-
Molecular Construction
-
N-term
-
6*His
-
PKI-beta (M1-K78)
Accession # Q9C010-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PKIB; PKI-Beta; Prev. PRKACN2; CAMP-Dependent Protein Kinase Inhibitor; Protein Kinase (CAMP-Dependent, Catalytic) Inhibitor Beta; CAMP-Dependent Protein Kinase Inhibitor Beta; CAMP-Dependent Protein Kinase Inhibitor 2
-
AA Sequence
MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK
-
Predicted Molecular Mass
10.6 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 20% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
