PLA2G16 Protein, Human (His)

The PLA2G16 protein has dual functions, acting as a phospholipase to exert calcium-independent PLA1 and PLA2 activities, preferentially releasing fatty acids through PLA1. It also acts as an O-acyltransferase and N-acyltransferase, helping to form N-acylphosphatidylethanolamine (the precursor of N-acylethanolamine). PLA2G16 Protein, Human (His) is the recombinant human-derived PLA2G16 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PLA2G16 protein has dual functions, acting as a phospholipase to exert calcium-independent PLA1 and PLA2 activities, preferentially releasing fatty acids through PLA1. It also acts as an O-acyltransferase and N-acyltransferase, helping to form N-acylphosphatidylethanolamine (the precursor of N-acylethanolamine). PLA2G16 Protein, Human (His) is the recombinant human-derived PLA2G16 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PLA2G16 protein exhibits a dual functionality, encompassing both phospholipase A1/2 and acyltransferase activities. As a phospholipase, it displays both calcium-independent PLA1 and PLA2 activities, efficiently releasing fatty acids from the sn-1 or sn-2 position of glycerophospholipids, with a notable prevalence of PLA1 activity. Additionally, PLA2G16 acts as an O-acyltransferase, facilitating the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid, and as an N-acyltransferase, catalyzing the calcium-independent transfer of a fatty acyl group from phosphatidylcholine and other glycerophospholipids to the primary amine of phosphatidylethanolamine. This process forms N-acylphosphatidylethanolamine, a precursor for N-acylethanolamines. Beyond its lipid-modifying enzymatic activities, PLA2G16 plays a crucial role in organelle rupture and degradation during eye lens terminal differentiation, contributing to lens transparency. Moreover, in the context of microbial infection, it acts as a host factor for picornaviruses, facilitating viral genome release into the cytoplasm during early infection and serving as a cellular sensor of membrane damage at virus entry sites. This multifaceted functionality underscores the diverse roles of PLA2G16 in cellular and infection-related processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • PLA2G16 (D12-D132)
      Accession # P53816
    • C-term
  • Protein Length

    Full Length of LRAT Domain

  • Synonyms

    PLAAT3; H-Rev 107 Protein Homolog; Prev. HRASLS3; Adipose-Specific PLA2; Prev. PLA2G16; MGC118754.; HREV107-3; HREV107-1; HREV107; H-REV107; AdPLA; HRSL3; HRAS-Like Suppressor 3; Phospholipase A/Acyltransferase‐3; H-REV107-1; Ca-Independent Phospholipase

  • AA Sequence

    DLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD

  • Molecular Weight

    Approximately 14-17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00