PNLIPRP2 Protein, Human (HEK293, His)
PNLIPRP2 Protein, Human (HEK293, His) is the recombinant human-derived PNLIPRP2 protein, expressed by HEK293, with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PNLIPRP2 Protein, Human (HEK293, His) is the recombinant human-derived PNLIPRP2 protein, expressed by HEK293, with C-6*His labeled tag.
Background
Pancreatic lipase-related protein 2 is a type of lipase that hydrolyzes triglycerides and galactoglycerol. In newborns, it may play a major role in the pancreas digesting dietary fats, such as butterfat globules, which are rich in long-chain triglycerides. PNLIPRP2 has low phospholipase activity and facilitates perforin-dependent cell lysis in cytotoxic T cells. The OPPC-rich lipid membrane domain produced by PNLIPRP2 recruits the protein STX4 by selectively interacting with the STX4 transmembrane domain to promote the fusion of the SLC6A-containing transport vesicles with the plasma membrane, and promote the surface expression of the dopamine transporter SLC6A3/DAT on the neurite tip[1][2][3][4].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
AAH05989.1 (K18-C469)
-
Molecular Construction
-
N-term
-
PNLIPRP2 (K18-C469)
Accession # AAH05989.1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Pancreatic lipase-related protein 2 Chain
-
Synonyms
PNLIPRP2; Cytotoxic T Lymphocyte Lipase; Pancreatic Lipase Related Protein 2 (Gene/Pseudogene); Galactolipase; PLRP2; Pancreatic Lipase Related Protein 2; Triacylglycerol Lipase; Pancreatic Lipase; Pancreatic Lipase-Related Protein 2; PL-RP2
-
AA Sequence
KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC
-
Predicted Molecular Mass
51.2 kDa
-
Molecular Weight
Approximately 62 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
