PNLIPRP2 Protein, Human (HEK293, His)

PNLIPRP2 Protein, Human (HEK293, His) is the recombinant human-derived PNLIPRP2 protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PNLIPRP2 Protein, Human (HEK293, His) is the recombinant human-derived PNLIPRP2 protein, expressed by HEK293, with C-6*His labeled tag.

Background

Pancreatic lipase-related protein 2 is a type of lipase that hydrolyzes triglycerides and galactoglycerol. In newborns, it may play a major role in the pancreas digesting dietary fats, such as butterfat globules, which are rich in long-chain triglycerides. PNLIPRP2 has low phospholipase activity and facilitates perforin-dependent cell lysis in cytotoxic T cells. The OPPC-rich lipid membrane domain produced by PNLIPRP2 recruits the protein STX4 by selectively interacting with the STX4 transmembrane domain to promote the fusion of the SLC6A-containing transport vesicles with the plasma membrane, and promote the surface expression of the dopamine transporter SLC6A3/DAT on the neurite tip[1][2][3][4].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PNLIPRP2 (K18-C469)
      Accession # AAH05989.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Pancreatic lipase-related protein 2 Chain

  • Synonyms

    PNLIPRP2; Cytotoxic T Lymphocyte Lipase; Pancreatic Lipase Related Protein 2 (Gene/Pseudogene); Galactolipase; PLRP2; Pancreatic Lipase Related Protein 2; Triacylglycerol Lipase; Pancreatic Lipase; Pancreatic Lipase-Related Protein 2; PL-RP2

  • AA Sequence

    KEVCYGQLGCFSDEKPWAGTLQRPVKLLPWSPEDIDTRFLLYTNENPNNFQLITGTEPDTIEASNFQLDRKTRFIIHGFLDKAEDSWPSDMCKKMFEVEKVNCICVDWRHGSRAMYTQAVQNIRVVGAETAFLIQALSTQLGYSLEDVHVIGHSLGAHTAAEAGRRLGGRVGRITGLDPAGPCFQDEPEEVRLDPSDAVFVDVIHTDSSPIVPSLGFGMSQKVGHLDFFPNGGKEMPGCKKNVLSTITDIDGIWEGIGGFVSCNHLRSFEYYSSSVLNPDGFLGYPCASYDEFQESKCFPCPAEGCPKMGHYADQFKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVNGYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNVGKIQKVKFLWNKRGINLSEPKLGASQITVQSGEDGTEYNFCSSDTVEENVLQSLYPC

  • Predicted Molecular Mass

    51.2 kDa

  • Molecular Weight

    Approximately 62 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00