PPP1CC Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PPP1CC protein is a multifunctional phosphatase that forms a specific holoenzyme with more than 200 regulatory proteins to dephosphorylate various biological targets. PPP1CC is critical for cell division and regulates glycogen metabolism, muscle contractility, and protein synthesis. PPP1CC Protein, Human (His) is the recombinant human-derived PPP1CC protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PPP1CC protein is a multifunctional phosphatase that forms a specific holoenzyme with more than 200 regulatory proteins to dephosphorylate various biological targets. PPP1CC is critical for cell division and regulates glycogen metabolism, muscle contractility, and protein synthesis. PPP1CC Protein, Human (His) is the recombinant human-derived PPP1CC protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Background

PPP1CC protein, a versatile phosphatase, forms highly specific holoenzymes by associating with over 200 regulatory proteins, collectively orchestrating the dephosphorylation of numerous biological targets. Essential for cell division, PPP1CC contributes to the regulation of glycogen metabolism, muscle contractility, and protein synthesis. Among its diverse functions, PPP1CC dephosphorylates RPS6KB1, participates in the regulation of ionic conductances and long-term synaptic plasticity, and may play a crucial role in dephosphorylating substrates like the postsynaptic density-associated Ca(2+)/calmodulin-dependent protein kinase II. As a component of the PTW/PP1 phosphatase complex, PPP1CC is integral in controlling chromatin structure and cell cycle progression during the transition from mitosis into interphase. Collaborating with CSNK1D and CSNK1E, PPP1CC determines circadian period length by regulating the speed and rhythmicity of PER1 and PER2 phosphorylation. Moreover, PPP1CC exhibits the capability to dephosphorylate CSNK1D and CSNK1E. Notably, PPP1CC targets FOXP3 in regulatory T-cells from rheumatoid arthritis patients, dephosphorylating the 'Ser-418' residue and rendering FOXP3 functionally defective, thereby contributing to Treg cell dysfunction. The myriad roles of PPP1CC underscore its central position in the intricate network of cellular signaling and regulatory processes.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • PPP1CC (M1-K323)
      Accession # P36873-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PPP1CC; PP-1G; Protein Phosphatase 1 Catalytic Subunit Gamma; Protein Phosphatase 1, Catalytic Subunit, Gamma Isoform; PP1C; Serine/Threonine Phosphatase 1 Gamma; Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit; Protein-Serine/Threonine P

  • AA Sequence

    MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

  • Predicted Molecular Mass

    40.2 kDa

  • Molecular Weight

    Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, pH 8.0 or 20mM Tris-HCl, 8% Trehalose, 10% Glycerol,300mM NaCl,1mM TCEP,0.03% Tween80,pH8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00