PPY Protein, Human (HEK293, His)
Based on 1 Customer Validation
PPY, a pancreatic hormone, regulates pancreatic and gastrointestinal functions. Its action may involve signaling through the G protein-coupled receptor NPY4R2, coordinating processes for homeostasis in both systems. PPY Protein, Human (HEK293, His) is the recombinant human-derived PPY protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PPY, a pancreatic hormone, regulates pancreatic and gastrointestinal functions. Its action may involve signaling through the G protein-coupled receptor NPY4R2, coordinating processes for homeostasis in both systems. PPY Protein, Human (HEK293, His) is the recombinant human-derived PPY protein, expressed by HEK293 , with C-6*His labeled tag.
Background
PPY, a hormone secreted by pancreatic cells, serves as a crucial regulator of both pancreatic and gastrointestinal functions. Its mode of action likely involves signaling through the G protein-coupled receptor NPY4R2, orchestrating intricate processes to maintain homeostasis and coordinate responses within the pancreatic and gastrointestinal systems.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P01298 (A30-R88)
-
Molecular Construction
-
N-term
-
PPY (A30-R88)
Accession # P01298 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PPY; Pancreatic Polypeptide Prohormone; Pancreatic Polypeptide; PH; PNP; Pancreatic Prohormone; Pancreatic Polypeptide Y; Obinepitide; Prepro-PP (Prepropancreatic Polypeptide); PP
-
AA Sequence
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPR
-
Predicted Molecular Mass
7.8 kDa
-
Molecular Weight
Approximately 12—14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
