PRAK/MAPKAPK5 Protein, Human (sf9, Strep)
PRAK/MAPKAPK5 protein, a serine/threonine kinase, responds to cellular stress and pro-inflammatory cytokines and acts as a tumor suppressor through MAP kinases (including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta) activated by phosphorylation. Initially located in the nucleus, upon activation, it moves to the cytoplasm and phosphorylates the heat shock protein HSP27. PRAK/MAPKAPK5 Protein, Human (sf9, Strep) is the recombinant human-derived PRAK protein, expressed by Sf9 insect cells, with C-Strep labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PRAK/MAPKAPK5 protein, a serine/threonine kinase, responds to cellular stress and pro-inflammatory cytokines and acts as a tumor suppressor through MAP kinases (including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta) activated by phosphorylation. Initially located in the nucleus, upon activation, it moves to the cytoplasm and phosphorylates the heat shock protein HSP27. PRAK/MAPKAPK5 Protein, Human (sf9, Strep) is the recombinant human-derived PRAK protein, expressed by Sf9 insect cells, with C-Strep labeled tag.
Background
The PRAK/MAPKAPK5 Protein, belonging to the serine/threonine kinase family, functions as a tumor suppressor and responds to cellular stress and proinflammatory cytokines by getting activated through phosphorylation by MAP kinases, including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. While initially located in the nucleus, upon phosphorylation and activation, it translocates to the cytoplasm. A notable target of this kinase is the heat shock protein HSP27, phosphorylating it at physiologically relevant sites. This gene displays two alternatively spliced transcript variants encoding distinct isoforms. PRAK/MAPKAPK5 exhibits ubiquitous expression, with discernible levels in the small intestine (RPKM 3.1), colon (RPKM 2.9), and 25 other tissues, emphasizing its widespread involvement in diverse physiological contexts across multiple organs.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-Strep
-
Accession
Q8IW41-2/NP_003659.2 (M1-Q471)
-
Gene ID8550
-
Protein Length
Full Length of Isoform-2
-
Synonyms
MAPKAPK5; MAPKAP Kinase 5; MAPK Activated Protein Kinase 5; MAPKAP-K5; PRAK; MAPKAPK-5; MK5; MK-5; Mitogen-Activated Protein Kinase-Activated Protein Kinase 5; Non-Specific Serine/Threonine Protein Kinase; P38-Regulated/Activated Protein Kinase; MAPK-Acti
-
AA Sequence
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
-
Predicted Molecular Mass
55.6 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.;≥ 95%, as determined by HPLC.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
