1. Recombinant Proteins
  2. Enzymes & Regulators Others Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CAMK
  4. MAPK Family MAPKAPK
  5. MAPKAPK5/PRAK
  6. PRAK/MAPKAPK5 Protein, Human (sf9, Strep)

PRAK/MAPKAPK5 protein, a serine/threonine kinase, responds to cellular stress and pro-inflammatory cytokines and acts as a tumor suppressor through MAP kinases (including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta) activated by phosphorylation. Initially located in the nucleus, upon activation, it moves to the cytoplasm and phosphorylates the heat shock protein HSP27. PRAK/MAPKAPK5 Protein, Human (sf9, Strep) is the recombinant human-derived PRAK protein, expressed by Sf9 insect cells, with C-Strep labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRAK/MAPKAPK5 protein, a serine/threonine kinase, responds to cellular stress and pro-inflammatory cytokines and acts as a tumor suppressor through MAP kinases (including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta) activated by phosphorylation. Initially located in the nucleus, upon activation, it moves to the cytoplasm and phosphorylates the heat shock protein HSP27. PRAK/MAPKAPK5 Protein, Human (sf9, Strep) is the recombinant human-derived PRAK protein, expressed by Sf9 insect cells, with C-Strep labeled tag.

Background

The PRAK/MAPKAPK5 Protein, belonging to the serine/threonine kinase family, functions as a tumor suppressor and responds to cellular stress and proinflammatory cytokines by getting activated through phosphorylation by MAP kinases, including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. While initially located in the nucleus, upon phosphorylation and activation, it translocates to the cytoplasm. A notable target of this kinase is the heat shock protein HSP27, phosphorylating it at physiologically relevant sites. This gene displays two alternatively spliced transcript variants encoding distinct isoforms. PRAK/MAPKAPK5 exhibits ubiquitous expression, with discernible levels in the small intestine (RPKM 3.1), colon (RPKM 2.9), and 25 other tissues, emphasizing its widespread involvement in diverse physiological contexts across multiple organs.

Species

Human

Source

Sf9 insect cells

Tag

C-Strep

Accession

Q8IW41-2/NP_003659.2 (M1-Q471)

Gene ID

8550

Protein Length

Full Length

AA Sequence

MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ

Predicted Molecular Mass
55.6 kDa
Molecular Weight

Approximately 35-45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 90%, as determined by reducing SDS-PAGE.;≥ 95%, as determined by HPLC.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRAK/MAPKAPK5 Protein, Human (sf9, Strep)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRAK/MAPKAPK5 Protein, Human (sf9, Strep)
Cat. No.:
HY-P703736
Quantity:
MCE Japan Authorized Agent: