PRKG1 Protein, Human (Active, sf9, GST)

PRKG1 is a serine/threonine protein kinase that mediates the NO/c signaling pathway and phosphorylates various cellular proteins. It affects platelet activation, smooth muscle contraction, cardiac function, central nervous system processes, etc. PRKG1 Protein, Human (sf9, GST) is the recombinant human-derived PRKG1, expressed by Sf9 insect cells, with GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PRKG1 is a serine/threonine protein kinase that mediates the NO/c signaling pathway and phosphorylates various cellular proteins. It affects platelet activation, smooth muscle contraction, cardiac function, central nervous system processes, etc. PRKG1 Protein, Human (sf9, GST) is the recombinant human-derived PRKG1, expressed by Sf9 insect cells, with GST labeled tag.

Background

PRKG1, a serine/threonine protein kinase, serves as a key mediator in the nitric oxide (NO)/csignaling pathway. Activation by enables PRKG1 to phosphorylate serines and threonines on various cellular proteins, influencing multiple cellular processes. The protein targets of PRKG1 are diverse, impacting platelet activation and adhesion, smooth muscle contraction, cardiac function, gene expression, and feedback of the NO-signaling pathway. Within the central nervous system, PRKG1 plays roles in axon guidance, hippocampal and cerebellar learning, circadian rhythm, and nociception. Smooth muscle relaxation is achieved through the reduction of intracellular free calcium, desensitization of contractile proteins to calcium, and the modulation of platelet activation. PRKG1 regulates intracellular calcium levels through pathways such as phosphorylation of IRAG1, inhibition of IP3-induced Ca(2+) release, and phosphorylation of KCNMA1 (BKCa) channels. Additionally, PRKG1 influences gene expression in various tissues, impacting smooth muscle-specific contractile proteins and proteins in the NO/csignaling pathway. The activation of PRKG1 by NO signaling also plays a crucial role in inhibiting the Ras homolog gene family member A (RhoA), affecting processes like RHOA translocation, contraction, vesicle trafficking, and myosin light chain phosphorylation, ultimately leading to vasorelaxation. Furthermore, PRKG1 regulates the functions of vasodilator-stimulated phosphoprotein (VASP) in platelets and smooth muscle.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    PRKG1; CGKI; Prev. PRKGR1B; Protein Kinase, CGMP-Dependent, Regulatory, Type I, Beta; Prev. PRKG1B; CGMP-Dependent Protein Kinase I; PKG1; CGMP-Dependent Protein Kinase; PKG; CGKI-Alpha; Protein Kinase, CGMP-Dependent, Type I; CGKI-BETA; CGMP-Dependent Pr

  • AA Sequence

    MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00