1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. PRKN Protein, Human (His, SUMO)

PRKN Protein, Human (His, SUMO) is the recombinant human-derived PRKN, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRKN Protein, Human (His, SUMO) is the recombinant human-derived PRKN, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

Parkin is a component of a multiprotein E3 ubiquitin ligase complex that catalyzes the covalent attachment of ubiquitin moieties to substrate proteins, including SYT11, VDAC1, BCL2, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPTIN5, TOMM20, USP30, ZNF746, MIRO1, and AIMP2. It mediates monoubiquitination as well as context-dependent 'Lys-6'-, 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination. Parkin participates in the removal or detoxification of misfolded or damaged proteins by mediating 'Lys-63'-linked polyubiquitination, leading to their recruitment to aggresomes and subsequent degradation. It also plays a role in Lewy-body formation through 'Lys-63'-linked polyubiquitination of SNCAIP. During cellular stress, Parkin acts downstream of PINK1 to protect mitochondrial function by coordinating quality control mechanisms, ranging from preventing apoptosis and stimulating mitochondrial biogenesis to regulating dynamics and eliminating damaged mitochondria via mitophagy. Together with PINK1, Parkin mediates the decision between mitophagy and apoptosis inhibition by ubiquitinating VDAC1. It regulates mitochondrial motility by ubiquitinating and degrading MIRO1 and MIRO2 and promotes mitochondrial biogenesis by degrading the transcriptional repressor ZNF746/PARIS via 'Lys-48'-linked polyubiquitination. Parkin also limits reactive oxygen species (ROS) production, regulates cyclin-E during neuronal apoptosis, and independently of its ubiquitin ligase activity, protects against apoptosis by transcriptionally repressing p53/TP53.

Biological Activity

Immobilized Human PRKN at 2.5 μg/mL (100μl/well) on the plate can bind Anti-PRKN Antibody. The ED50 for this effect is 79.06 ng/mL.

  • Immobilized Human PRKN at 2.5 μg/mL (100μl/well) on the plate can bind Anti-PRKN Antibody. The ED50 for this effect is 79.06 ng/mL.
Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

O60260-1 (M1-V465)

Gene ID

5071

Molecular Construction
N-term
6*His-SUMO
PRKN (M1-V465)
Accession # O60260-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
E3 ubiquitin-protein ligase parkin; Parkin; PARK2; Parkin RBR E3 ubiquitin-protein ligase
AA Sequence

MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV

Predicted Molecular Mass
63.6 kDa
Molecular Weight

Approximately 70 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0, 1 mM TCEP, 0.1% Brij-35, 5% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PRKN Protein, Human (His, SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRKN Protein, Human (His, SUMO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRKN Protein, Human (His, SUMO)
Cat. No.:
HY-P702806
Quantity:
MCE Japan Authorized Agent: