PRKN Protein, Human (His, SUMO)

Customer Review

Based on 1 Customer Validation

PRKN Protein, Human (His, SUMO) is the recombinant human-derived PRKN, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PRKN Protein, Human (His, SUMO) is the recombinant human-derived PRKN, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

Parkin is a component of a multiprotein E3 ubiquitin ligase complex that catalyzes the covalent attachment of ubiquitin moieties to substrate proteins, including SYT11, VDAC1, BCL2, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPTIN5, TOMM20, USP30, ZNF746, MIRO1, and AIMP2. It mediates monoubiquitination as well as context-dependent 'Lys-6'-, 'Lys-11'-, 'Lys-48'-, and 'Lys-63'-linked polyubiquitination. Parkin participates in the removal or detoxification of misfolded or damaged proteins by mediating 'Lys-63'-linked polyubiquitination, leading to their recruitment to aggresomes and subsequent degradation. It also plays a role in Lewy-body formation through 'Lys-63'-linked polyubiquitination of SNCAIP. During cellular stress, Parkin acts downstream of PINK1 to protect mitochondrial function by coordinating quality control mechanisms, ranging from preventing apoptosis and stimulating mitochondrial biogenesis to regulating dynamics and eliminating damaged mitochondria via mitophagy. Together with PINK1, Parkin mediates the decision between mitophagy and apoptosis inhibition by ubiquitinating VDAC1. It regulates mitochondrial motility by ubiquitinating and degrading MIRO1 and MIRO2 and promotes mitochondrial biogenesis by degrading the transcriptional repressor ZNF746/PARIS via 'Lys-48'-linked polyubiquitination. Parkin also limits reactive oxygen species (ROS) production, regulates cyclin-E during neuronal apoptosis, and independently of its ubiquitin ligase activity, protects against apoptosis by transcriptionally repressing p53/TP53.

Verified Bioactivity

Immobilized Human PRKN at 2.5 μg/mL (100μl/well) on the plate can bind Anti-PRKN Antibody. The ED50 for this effect is 79.06 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Human PRKN at 2.5 μg/mL (100μl/well) on the plate can bind Anti-PRKN Antibody. The ED50 for this effect is 79.06 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • PRKN (M1-V465)
      Accession # O60260-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PRKN; Parkinson Juvenile Disease Protein 2; Prev. PARK2; Parkinson Protein 2 E3 Ubiquitin Protein Ligase; E3 Ubiquitin-Protein Ligase Parkin; Truncated Parkin Variant SV3,8,9DEL; Parkin; Truncated Parkin Variant SV4,8DEL; AR-JP; Truncated Parkin Variant S

  • AA Sequence

    MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV

  • Predicted Molecular Mass

    63.6 kDa

  • Molecular Weight

    Approximately 70 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCl, pH 8.0, 1 mM TCEP, 0.1% Brij-35, 5% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00