PRMT5 Protein, Human (HEK293, His-Flag)
PRMT5 protein, an enzyme from the methyltransferase family, methylates arginine in target proteins like histones, p53, and transcription factors. It regulates transcription and small nuclear ribonucleoprotein assembly. Alternative splicing generates diverse PRMT5 transcript variants. It is widely expressed, particularly in the thyroid, ovary, and other tissues, emphasizing its crucial role in cellular processes. PRMT5 Protein, Human (HEK293, His-Flag) is the recombinant human-derived PRMT5, expressed by HEK293, with N-Flag, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PRMT5 protein, an enzyme from the methyltransferase family, methylates arginine in target proteins like histones, p53, and transcription factors. It regulates transcription and small nuclear ribonucleoprotein assembly. Alternative splicing generates diverse PRMT5 transcript variants. It is widely expressed, particularly in the thyroid, ovary, and other tissues, emphasizing its crucial role in cellular processes. PRMT5 Protein, Human (HEK293, His-Flag) is the recombinant human-derived PRMT5, expressed by HEK293, with N-Flag, C-His labeled tag.
Background
PRMT5 encodes an enzyme belonging to the methyltransferase family, responsible for catalyzing the transfer of methyl groups to the amino acid arginine in various target proteins, such as histones, transcriptional elongation factors, and the tumor suppressor p53. The gene plays a crucial role in diverse cellular processes, including transcriptional regulation and the assembly of small nuclear ribonucleoproteins. Additionally, alternative splicing events give rise to multiple transcript variants, contributing to the functional diversity of PRMT5. This enzyme exhibits ubiquitous expression across various tissues, with notable presence in the thyroid, ovary, and numerous other tissues, underscoring its importance in fundamental cellular functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Flag;C-His
-
Accession
O14744-1/NP_006100.2 (A2-L637)
-
Molecular Construction
-
N-term
-
Flag
-
PRMT5 (A2-L637)
Accession # O14744-1/NP_006100.2 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PRMT5; Jak-Binding Protein 1; Prev. HRMT1L5; IBP72; Prev. SKB1; JBP1; SKB1Hs; HMT1 HnRNP Methyltransferase-Like 5; Histone-Arginine N-Methyltransferase PRMT5; Skb1 (S. Pombe) Homolog; Protein Arginine N-Methyltransferase 5; SKB1 Homolog (S. Pombe); Shk1 Kinase-Binding Protein 1 Homolog; HSL7; 72 KDa ICln-Binding Protein; Protein Arginine Methyltransferase 5; SKB1 Homolog
-
AA Sequence
AAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
-
Predicted Molecular Mass
75.1 kDa
-
Molecular Weight
Approximately 65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
