Prokineticin-1/EG-VEGF Protein, Human

Customer Review

Based on 1 Customer Validation

Prokineticin-1/EG-VEGF protein is a potent regulator of gastrointestinal smooth muscle contraction and affects intestinal motility. Its multifaceted effects extend to capillary endothelial cells, inducing proliferation, migration, and fenestration and are specific to certain cell types. Prokineticin-1/EG-VEGF Protein, Human is the recombinant human-derived Prokineticin-1/EG-VEGF protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Prokineticin-1/EG-VEGF protein is a potent regulator of gastrointestinal smooth muscle contraction and affects intestinal motility. Its multifaceted effects extend to capillary endothelial cells, inducing proliferation, migration, and fenestration and are specific to certain cell types. Prokineticin-1/EG-VEGF Protein, Human is the recombinant human-derived Prokineticin-1/EG-VEGF protein, expressed by E. coli , with tag free.

Background

Prokineticin-1/EG-VEGF Protein stands out as a potent regulator of gastrointestinal (GI) smooth muscle contraction, highlighting its role in modulating gut motility. Beyond its influence on smooth muscle, this protein exhibits a multifaceted impact on capillary endothelial cells derived from endocrine glands, inducing proliferation, migration, and fenestration. Importantly, Prokineticin-1/EG-VEGF demonstrates specificity by having little or no effect on various other endothelial and non-endothelial cell types. Its role extends to the enteric neural crest cells, where it induces proliferation and differentiation. In neuroblastoma progression, this protein directly influences the proliferation and migration of neuroblastoma cells, implicating its involvement in tumor dynamics. Additionally, Prokineticin-1/EG-VEGF positively regulates PTGS2 expression and prostaglandin synthesis, suggesting a potential role in inflammatory responses. With implications in placentation and normal as well as pathological testis angiogenesis, Prokineticin-1/EG-VEGF emerges as a versatile signaling molecule with diverse cellular effects across various physiological and pathological contexts.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human EG-VEGF at 2 μg/mL can bind Anti-EG-VEGF antibody. The ED50 for this effect is 42.32 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human EG-VEGF at 2 μg/mL can bind Anti-EG-VEGF antibody. The ED50 for this effect is 42.32 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • EG-VEGF (A20-F105)
      Accession # P58294
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PROK1; PK1; Prokineticin 1; Endocrine-Gland-Derived Vascular Endothelial Growth Factor; EG-VEGF; Black Mamba Toxin-Related Protein; Mambakine; Prokineticin-1; EGVEGF; Endocrine Gland-Derived Vascular Endothelial Growth Factor; PRK1

  • AA Sequence

    AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF

  • Predicted Molecular Mass

    9.7 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 0.02% Tween20, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00