Prolactin Protein, Rat (His)

Prolactin Protein primarily promotes lactation by exerting its main actions on the mammary gland. This crucial function is facilitated through interaction with its specific receptor, PRLR. Prolactin Protein, Rat (His) is the recombinant rat-derived Prolactin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Prolactin Protein, Rat (His) is 197 a.a., with molecular weight of ~24 kDa.

Prolactin protein exerts its main actions on the mammary gland, primarily promoting lactation. This crucial function is achieved through its interaction with the specific receptor known as PRLR, which facilitates the process of lactation.

Measured in a cell proliferation assay using Nb211 rat lymphoma cells. The ED₅₀ for this effect is 0.288 ng/mL, corresponding to a specific activity is 3.472×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using Nb211 rat lymphoma cells. The ED₅₀ for this effect is 0.288 ng/mL, corresponding to a specific activity is 3.472×10⁶ units/mg.

Rat

E. coli

N-6*His

P01237 (L30-C226)

24683  [NCBI]

LPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC

Approximately 24 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.