Prolactin Protein, Rat (His)
Based on 1 Customer Validation
Prolactin Protein primarily promotes lactation by exerting its main actions on the mammary gland.This crucial function is facilitated through interaction with its specific receptor, PRLR.Prolactin Protein, Rat (His) is the recombinant rat-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Prolactin Protein primarily promotes lactation by exerting its main actions on the mammary gland.This crucial function is facilitated through interaction with its specific receptor, PRLR.Prolactin Protein, Rat (His) is the recombinant rat-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.
Background
Prolactin protein exerts its main actions on the mammary gland, primarily promoting lactation. This crucial function is achieved through its interaction with the specific receptor known as PRLR, which facilitates the process of lactation.
Verified Bioactivity
Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.288-0.5528 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-6*His
-
Accession
P01237 (L30-C226)
-
Molecular Construction
-
N-term
-
6*His
-
Prolactin (L30-C226)
Accession # P01237 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRL; PPRL; Prolactin; GHA1; Luteotropic Hormone; Decidual Prolactin; Prolactin Peptide; Growth Hormone A1; Luteotropin
-
AA Sequence
LPVCSGGDCQTPLPELFDRVVMLSHYIHTLYTDMFIEFDKQYVQDREFIAKAINDCPTSSLATPEDKEQAQKVPPEVLLNLILSLVHSWNDPLFQLITGLGGIHEAPDAIISRAKEIEEQNKRLLEGIEKIISQAYPEAKGNEIYLVWSQLPSLQGVDEESKDLAFYNNIRCLRRDSHKVDNYLKFLRCQIVHKNNC
-
Predicted Molecular Mass
22.5 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
