PSMA Protein, Human (HEK293, His, solution)
PSMA Protein is a type II transmembrane glycoprotein highly expressed on the surface of prostate cancer cells. PSMA Protein hydrolyzes extracellular polyglutamic acid folate into monoglutamic acid folate through folate hydrolase activity, improving the uptake efficiency of folate by tumor cells to support proliferation; and participates in neuropeptide metabolism through NAALADase activity. PSMA Protein, Human (HEK293, His, solution) is a recombinant PSMA protein expressed by HEK293 with an N-6*His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
PSMA Protein is a type II transmembrane glycoprotein highly expressed on the surface of prostate cancer cells. PSMA Protein hydrolyzes extracellular polyglutamic acid folate into monoglutamic acid folate through folate hydrolase activity, improving the uptake efficiency of folate by tumor cells to support proliferation; and participates in neuropeptide metabolism through NAALADase activity. PSMA Protein, Human (HEK293, His, solution) is a recombinant PSMA protein expressed by HEK293 with an N-6*His tag.
Background
PSMA Protein belongs to the M28 peptidase family[1]. PSMA Protein is a type II transmembrane glycoprotein highly expressed on the surface of prostate cancer cells[1][2] [5]. PSMA Protein hydrolyzes extracellular polyglutamic acid folate into monoglutamic acid folate through folate hydrolase activity, thereby increasing the efficiency of folate uptake by tumor cells to support proliferation; it participates in neuropeptide metabolism through NAALADase activity; its expression may mediate tumor angiogenesis by promoting integrin signaling[1][5]. PSMA Protein is expressed at low levels in normal prostate epithelial cells, renal proximal tubules, central nervous system, small intestinal mucosal cells and salivary glands, and is significantly expressed at high levels in prostate cancer cells and neovascular endothelial cells of various solid tumors[1][2][5]. PSMA Protein, Human is composed of 750 amino acid residues, including a 19-amino acid intracellular domain, a 24-amino acid transmembrane domain and a 707-amino acid extracellular domain. The extracellular domain contains 10 N-glycosylation sites. Glycosylation modification affects its stability and function[1][4].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Accession
Q04609-1 (K44-A750)
-
Molecular Construction
-
N-term
-
6*His
-
PSMA (K44-A750)
Accession # Q04609-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FOLH1; Folylpoly-Gamma-Glutamate Carboxypeptidase; Prev. FOLH; Membrane Glutamate Carboxypeptidase; NAALAD1; Glutamate Carboxylase II; GCPII; NAALADase I; PSMA; NAALAdase; PSM; FGCP; Glutamate Carboxypeptidase II; MGCP; Glutamate Carboxypeptidase 2; Folat
-
AA Sequence
KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
-
Predicted Molecular Mass
80.6 kDa
-
Molecular Weight
Approximately 90-120 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (267 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Yao V, et al. Expression of prostate-specific membrane antigen (PSMA), increases cell folate uptake and proliferation and suggests a novel role for PSMA in the uptake of the non-polyglutamated folate, folic acid. Prostate. 2010 Feb 15;70(3):305-16. [Content Brief]
[2]. Kranzbühler B, et al. Pharmacological upregulation of prostate-specific membrane antigen (PSMA) expression in prostate cancer cells. Prostate. 2018 Jul;78(10):758-765. [Content Brief]
[3]. Hrkach J, et al. Preclinical development and clinical translation of a PSMA-targeted docetaxel nanoparticle with a differentiated pharmacological profile. Sci Transl Med. 2012 Apr 4;4(128):128ra39. [Content Brief]
[4]. Yuan W, et al. Glycoforms of human prostate-specific membrane antigen (PSMA) in human cells and prostate tissue. Prostate. 2022 Jan;82(1):132-144. [Content Brief]
[5]. Holmes EH. PSMA specific antibodies and their diagnostic and therapeutic use. Expert Opin Investig Drugs. 2001 Mar;10(3):511-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
