PSP Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PSP protein catalyzes the final irreversible step in carbohydrate biosynthesis of L-serine through dephosphorylation of O-phospho-L-serine. PSP Protein, Human (His) is the recombinant human-derived PSP protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PSP protein catalyzes the final irreversible step in carbohydrate biosynthesis of L-serine through dephosphorylation of O-phospho-L-serine. PSP Protein, Human (His) is the recombinant human-derived PSP protein, expressed by E. coli , with C-6*His labeled tag.

Background

Phosphoserine phosphatase (PSP) is responsible for catalyzing the final irreversible step in the biosynthesis of L-serine from carbohydrates, involving the dephosphorylation of O-phospho-L-serine to L-serine. This enzymatic activity is pivotal for various cellular processes, as L-serine serves as a precursor for protein synthesis, the generation of other amino acids, nucleotide metabolism, and glutathione synthesis. Additionally, L-serine can undergo racemization to form D-serine, which functions as a neuromodulator. PSP's role in regulating the availability of L-serine underscores its significance in diverse metabolic pathways and cellular functions. There is also a potential involvement in the dephosphorylation of O-phospho-D-serine, although this aspect remains to be confirmed.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PSP (M1-E225)
      Accession # P78330
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PSPH; L-3-Phosphoserine Phosphatase; Prev. PSP; PSPHD; O-Phosphoserine Phosphohydrolase; Phosphoserine Phosphatase; PSPase

  • AA Sequence

    MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE

  • Predicted Molecular Mass

    26.1 kDa

  • Molecular Weight

    Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 4 M Urea, 5 mM EDTA, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00