1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PTP1B Protein, Human (His)

PTP1B is an important tyrosine protein phosphatase that regulates the endoplasmic reticulum unfolded protein response by dephosphorylating EIF2AK3/PERK and inhibiting its kinase activity. It affects the signaling cascade induced by CKII and p60c-src, and may regulate the EFNA5-EPHA3 pathway, affecting cell reorganization. PTP1B Protein, Human (His) is the recombinant human-derived PTP1B protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE PTP1B Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PTP1B is an important tyrosine protein phosphatase that regulates the endoplasmic reticulum unfolded protein response by dephosphorylating EIF2AK3/PERK and inhibiting its kinase activity. It affects the signaling cascade induced by CKII and p60c-src, and may regulate the EFNA5-EPHA3 pathway, affecting cell reorganization. PTP1B Protein, Human (His) is the recombinant human-derived PTP1B protein, expressed by E. coli , with N-His labeled tag.

Background

PTP1B, a tyrosine-protein phosphatase, serves as a key regulator of the endoplasmic reticulum unfolded protein response. It acts by mediating the dephosphorylation of EIF2AK3/PERK, thereby inactivating the protein kinase activity of EIF2AK3/PERK. PTP1B is implicated in potential roles within CKII- and p60c-src-induced signal transduction cascades. Moreover, it may exert regulatory influence over the EFNA5-EPHA3 signaling pathway, involved in cell reorganization and cell-cell repulsion. Additionally, PTP1B is suggested to modulate the hepatocyte growth factor receptor signaling pathway through its ability to dephosphorylate MET. These multifaceted functions underscore the versatility of PTP1B in orchestrating diverse cellular processes and signaling pathways.

Biological Activity

1.Measured by its ability to dephosphorylate a phosphotyrosine residue in an EGF receptor (aa988-998) phosphopeptide substrate and the specific activity is >15 nmol/min/μg.
2.Measured by its ability to catalyzes the hydrolysis of the pNPP substrate that incubate at 37°C for 20 min. The specific activity is >10,000 nmol/min/μg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P18031 (E2-N321)

Gene ID
Molecular Construction
N-term
6*His
PTP1B (E2-N321)
Accession # P18031
C-term
Protein Length

Partial

Synonyms
PTP-1B; PTPN1; Tyrosine-protein phosphatase non-receptor type 1
AA Sequence

EMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN

Molecular Weight

Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 10 mM HEPES, 150 mM NaCl, 1 mM DTT, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PTP1B Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PTP1B Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTP1B Protein, Human (His)
Cat. No.:
HY-P73685
Quantity:
MCE Japan Authorized Agent: