Copy Link Print Information

PTP1B Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

PTP1B is an important tyrosine protein phosphatase that regulates the endoplasmic reticulum unfolded protein response by dephosphorylating EIF2AK3/PERK and inhibiting its kinase activity. It affects the signaling cascade induced by CKII and p60c-src, and may regulate the EFNA5-EPHA3 pathway, affecting cell reorganization. PTP1B Protein, Human (His) is the recombinant human-derived PTP1B protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for PTP1B Protein, Human (His)
  • PTP1B Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PTP1B is an important tyrosine protein phosphatase that regulates the endoplasmic reticulum unfolded protein response by dephosphorylating EIF2AK3/PERK and inhibiting its kinase activity. It affects the signaling cascade induced by CKII and p60c-src, and may regulate the EFNA5-EPHA3 pathway, affecting cell reorganization. PTP1B Protein, Human (His) is the recombinant human-derived PTP1B protein, expressed by E. coli , with N-His labeled tag.

Background

PTP1B, a tyrosine-protein phosphatase, serves as a key regulator of the endoplasmic reticulum unfolded protein response. It acts by mediating the dephosphorylation of EIF2AK3/PERK, thereby inactivating the protein kinase activity of EIF2AK3/PERK. PTP1B is implicated in potential roles within CKII- and p60c-src-induced signal transduction cascades. Moreover, it may exert regulatory influence over the EFNA5-EPHA3 signaling pathway, involved in cell reorganization and cell-cell repulsion. Additionally, PTP1B is suggested to modulate the hepatocyte growth factor receptor signaling pathway through its ability to dephosphorylate MET. These multifaceted functions underscore the versatility of PTP1B in orchestrating diverse cellular processes and signaling pathways.

Verified Bioactivity

1.Measured by its ability to dephosphorylate a phosphotyrosine residue in an EGF receptor (aa988-998) phosphopeptide substrate and the specific activity is >15 nmol/min/μg.
2.Measured by its ability to catalyzes the hydrolysis of the pNPP substrate that incubate at 37°C for 20 min. The specific activity is >10,000 nmol/min/μg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P18031 (E2-N321)

  • Gene ID
    5770  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • PTP1B (E2-N321)
      Accession # P18031
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PTPN1; Protein-Tyrosine Phosphatase 1B; Prev. PTP1B; Protein Tyrosine Phosphatase, Placental; Tyrosine-Protein Phosphatase Non-Receptor Type 1; PTP-1B; Protein Tyrosine Phosphatase Non-Receptor Type 1; Tyrosine-Protein Phosphatase Non-Receptor Type

  • AA Sequence

    EMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 10 mM HEPES, 150 mM NaCl, 1 mM DTT, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • PTP1B Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for PTP1B Protein, Human (His)
  • PTP1B Protein, Human (His) Product Image