PTP4A3 Protein, Human (His)

PTP4A3 Protein, a tyrosine phosphatase, accelerates cell cycle progression from G1 to S phase, fostering cell proliferation, motility, and invasion. Its role extends to promoting cancer metastasis, and it may contribute to cardiac hypertrophy progression by inhibiting intracellular calcium mobilization in response to angiotensin II. PTP4A3 Protein, Human (His) is the recombinant human-derived PTP4A3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PTP4A3 Protein, a tyrosine phosphatase, accelerates cell cycle progression from G1 to S phase, fostering cell proliferation, motility, and invasion. Its role extends to promoting cancer metastasis, and it may contribute to cardiac hypertrophy progression by inhibiting intracellular calcium mobilization in response to angiotensin II. PTP4A3 Protein, Human (His) is the recombinant human-derived PTP4A3 protein, expressed by E. coli , with N-His labeled tag.

Background

PTP4A3 protein, a member of the protein tyrosine phosphatase family, serves as a critical regulator in cell cycle progression, specifically promoting the transition from G1 to S phase during mitosis. Its influence extends beyond cell cycle dynamics, as it actively enhances cell proliferation, motility, and invasive behavior, thereby contributing to the promotion of cancer metastasis. Additionally, PTP4A3 appears to play a role in the progression of cardiac hypertrophy, potentially through the inhibition of intracellular calcium mobilization in response to angiotensin II. Unraveling the intricate signaling pathways and molecular mechanisms orchestrated by PTP4A3 is crucial for a comprehensive understanding of its diverse roles in cellular processes and pathological conditions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 8*His
    • PTP4A3 (M1-C170)
      Accession # O75365-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PTP4A3; Protein Tyrosine Phosphatase Type IVA 3; Protein Tyrosine Phosphatase 4A3; Protein Tyrosine Phosphatase Type IVA, Member 3; PRL-3; Phosphatase Of Regenerating Liver 3; PRL-R; Protein-Tyrosine Phosphatase 4a3; PRL3; Potentially Prenylated Protein T

  • AA Sequence

    MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRC

  • Predicted Molecular Mass

    20.3 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00