PTP4A3 Protein, Human (His)
PTP4A3 Protein, a tyrosine phosphatase, accelerates cell cycle progression from G1 to S phase, fostering cell proliferation, motility, and invasion. Its role extends to promoting cancer metastasis, and it may contribute to cardiac hypertrophy progression by inhibiting intracellular calcium mobilization in response to angiotensin II. PTP4A3 Protein, Human (His) is the recombinant human-derived PTP4A3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PTP4A3 Protein, a tyrosine phosphatase, accelerates cell cycle progression from G1 to S phase, fostering cell proliferation, motility, and invasion. Its role extends to promoting cancer metastasis, and it may contribute to cardiac hypertrophy progression by inhibiting intracellular calcium mobilization in response to angiotensin II. PTP4A3 Protein, Human (His) is the recombinant human-derived PTP4A3 protein, expressed by E. coli , with N-His labeled tag.
Background
PTP4A3 protein, a member of the protein tyrosine phosphatase family, serves as a critical regulator in cell cycle progression, specifically promoting the transition from G1 to S phase during mitosis. Its influence extends beyond cell cycle dynamics, as it actively enhances cell proliferation, motility, and invasive behavior, thereby contributing to the promotion of cancer metastasis. Additionally, PTP4A3 appears to play a role in the progression of cardiac hypertrophy, potentially through the inhibition of intracellular calcium mobilization in response to angiotensin II. Unraveling the intricate signaling pathways and molecular mechanisms orchestrated by PTP4A3 is crucial for a comprehensive understanding of its diverse roles in cellular processes and pathological conditions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-8*His
-
Accession
O75365-1 (M1-C170)
-
Molecular Construction
-
N-term
-
8*His
-
PTP4A3 (M1-C170)
Accession # O75365-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PTP4A3; Protein Tyrosine Phosphatase Type IVA 3; Protein Tyrosine Phosphatase 4A3; Protein Tyrosine Phosphatase Type IVA, Member 3; PRL-3; Phosphatase Of Regenerating Liver 3; PRL-R; Protein-Tyrosine Phosphatase 4a3; PRL3; Potentially Prenylated Protein T
-
AA Sequence
MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRC
-
Predicted Molecular Mass
20.3 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
