1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PTP4A3 Protein, Human (His)

PTP4A3 Protein, a tyrosine phosphatase, accelerates cell cycle progression from G1 to S phase, fostering cell proliferation, motility, and invasion. Its role extends to promoting cancer metastasis, and it may contribute to cardiac hypertrophy progression by inhibiting intracellular calcium mobilization in response to angiotensin II. PTP4A3 Protein, Human (His) is the recombinant human-derived PTP4A3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PTP4A3 Protein, a tyrosine phosphatase, accelerates cell cycle progression from G1 to S phase, fostering cell proliferation, motility, and invasion. Its role extends to promoting cancer metastasis, and it may contribute to cardiac hypertrophy progression by inhibiting intracellular calcium mobilization in response to angiotensin II. PTP4A3 Protein, Human (His) is the recombinant human-derived PTP4A3 protein, expressed by E. coli , with N-His labeled tag.

Background

PTP4A3 protein, a member of the protein tyrosine phosphatase family, serves as a critical regulator in cell cycle progression, specifically promoting the transition from G1 to S phase during mitosis. Its influence extends beyond cell cycle dynamics, as it actively enhances cell proliferation, motility, and invasive behavior, thereby contributing to the promotion of cancer metastasis. Additionally, PTP4A3 appears to play a role in the progression of cardiac hypertrophy, potentially through the inhibition of intracellular calcium mobilization in response to angiotensin II. Unraveling the intricate signaling pathways and molecular mechanisms orchestrated by PTP4A3 is crucial for a comprehensive understanding of its diverse roles in cellular processes and pathological conditions.

Species

Human

Source

E. coli

Tag

N-8*His

Accession

O75365-1 (M1-C170)

Gene ID
Molecular Construction
N-term
8*His
PTP4A3 (M1-C170)
Accession # O75365-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
PRL-R; Protein-tyrosine phosphatase 4a3; Protein-tyrosine phosphatase of regenerating liver 3; PRL-3; PRL3; PTP4A3
AA Sequence

MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRC

Predicted Molecular Mass
20.3 kDa
Molecular Weight

Approximately 20.3 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PTP4A3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PTP4A3 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTP4A3 Protein, Human (His)
Cat. No.:
HY-P701033
Quantity:
MCE Japan Authorized Agent: