RAMP3 Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
RAMP3 protein plays a crucial role in cardioprotection by attenuating cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. RAMP3 is multifunctional, promoting the transport of CALCRL and GPER1 to the plasma membrane and coordinating membrane-associated signaling. RAMP3 Protein, Human (HEK293, hFc) is the recombinant human-derived RAMP3 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
RAMP3 protein plays a crucial role in cardioprotection by attenuating cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. RAMP3 is multifunctional, promoting the transport of CALCRL and GPER1 to the plasma membrane and coordinating membrane-associated signaling. RAMP3 Protein, Human (HEK293, hFc) is the recombinant human-derived RAMP3 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
RAMP3 emerges as a key participant in cardioprotection, exerting its influence by mitigating cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Functionally versatile, RAMP3 facilitates the transportation of the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane, underscoring its role in orchestrating membrane-associated signaling events. Additionally, RAMP3 serves as a receptor for adrenomedullin (AM) alongside CALCRL, forming a heterodimeric complex that engages in molecular interactions crucial for mediating the effects of AM. The intricate interplay of RAMP3 with GPER1 further highlights its involvement in diverse cellular pathways and underscores its significance in cardiovascular physiology.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
O60896 (R24-V118)
-
Molecular Construction
-
N-term
-
RAMP3 (R24-V118)
Accession # O60896 -
hFc
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
RAMP3; Calcitonin Receptor-Like Receptor Activity Modifying Protein 3; Receptor Activity Modifying Protein 3; Calcitonin-Receptor-Like Receptor Activity-Modifying Protein 3; Receptor Activity-Modifying Protein 3; Receptor (Calcitonin) Activity Modifying P
-
AA Sequence
RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEV
-
Molecular Weight
Approximately 28-31 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
