RB1 Protein, Human (StrepⅡ)
RB1 Protein, Human (Strep) is the recombinant human-derived RB1, expressed by E. coli , with Strep labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RB1 Protein, Human (Strep) is the recombinant human-derived RB1, expressed by E. coli , with Strep labeled tag. ,
Background
Rb (Retinoblastoma protein) is a critical tumor suppressor that regulates the G1/S transition of the cell cycle. The hypophosphorylated form binds E2F family transcription regulators, repressing E2F-responsive gene transcription. Rb not only physically blocks E2F's transactivation domain but also recruits chromatin-modifying enzymes (e.g., histone methyltransferases SUV39H1, KMT5B, and KMT5C) to actively repress transcription, maintaining heterochromatin structure, particularly constitutive heterochromatin, and controlling histone H4 'Lys-20' trimethylation. CDK/cyclin-dependent phosphorylation induces Rb dissociation from E2F, activating E2F-responsive genes and triggering S-phase entry. Additionally, Rb promotes the G0-G1 transition upon phosphorylation by CDK3/cyclin-C. In neurons, Rb collaborates with SMARCA4/BRG1 to recruit an HDAC complex, repressing c-FOS promoter transcription; calcium influx triggers calcineurin-mediated Rb dephosphorylation, releasing the repressor complex (By similarity). During viral infection, SV40 large T antigen, HPV E7, or adenovirus E1A disrupts the Rb-E2F1 complex, impairing Rb's function.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-StrepⅡ
-
Accession
P06400 (S773-K928)
-
Gene ID5925
-
Protein Length
Full Length of Domain C; mediates interaction with E4F1 Region
-
Synonyms
RB1; P110-RB1; Prev. OSRC; Pp110; Retinoblastoma-Associated Protein; Mutant Retinoblastoma-Associated Protein; Retinoblastoma 1; Retinoblastoma Susceptibility Protein; PPP1R130; Mutated Retinoblastoma Protein; PRb; Retinoblastoma; RB; Osteosarcoma; Protei
-
AA Sequence
STRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)