RB1 Protein, Human (StrepⅡ)

RB1 Protein, Human (Strep) is the recombinant human-derived RB1, expressed by E. coli , with Strep labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RB1 Protein, Human (Strep) is the recombinant human-derived RB1, expressed by E. coli , with Strep labeled tag. ,

Background

Rb (Retinoblastoma protein) is a critical tumor suppressor that regulates the G1/S transition of the cell cycle. The hypophosphorylated form binds E2F family transcription regulators, repressing E2F-responsive gene transcription. Rb not only physically blocks E2F's transactivation domain but also recruits chromatin-modifying enzymes (e.g., histone methyltransferases SUV39H1, KMT5B, and KMT5C) to actively repress transcription, maintaining heterochromatin structure, particularly constitutive heterochromatin, and controlling histone H4 'Lys-20' trimethylation. CDK/cyclin-dependent phosphorylation induces Rb dissociation from E2F, activating E2F-responsive genes and triggering S-phase entry. Additionally, Rb promotes the G0-G1 transition upon phosphorylation by CDK3/cyclin-C. In neurons, Rb collaborates with SMARCA4/BRG1 to recruit an HDAC complex, repressing c-FOS promoter transcription; calcium influx triggers calcineurin-mediated Rb dephosphorylation, releasing the repressor complex (By similarity). During viral infection, SV40 large T antigen, HPV E7, or adenovirus E1A disrupts the Rb-E2F1 complex, impairing Rb's function.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-StrepⅡ
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Domain C; mediates interaction with E4F1 Region

  • Synonyms

    RB1; P110-RB1; Prev. OSRC; Pp110; Retinoblastoma-Associated Protein; Mutant Retinoblastoma-Associated Protein; Retinoblastoma 1; Retinoblastoma Susceptibility Protein; PPP1R130; Mutated Retinoblastoma Protein; PRb; Retinoblastoma; RB; Osteosarcoma; Protei

  • AA Sequence

    STRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00