1. Recombinant Proteins
  2. Others
  3. RB1 Protein, Human (StrepⅡ)

RB1 Protein, Human (Strep) is the recombinant human-derived RB1, expressed by E. coli , with Strep labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RB1 Protein, Human (Strep) is the recombinant human-derived RB1, expressed by E. coli , with Strep labeled tag. ,

Background

Rb (Retinoblastoma protein) is a critical tumor suppressor that regulates the G1/S transition of the cell cycle. The hypophosphorylated form binds E2F family transcription regulators, repressing E2F-responsive gene transcription. Rb not only physically blocks E2F's transactivation domain but also recruits chromatin-modifying enzymes (e.g., histone methyltransferases SUV39H1, KMT5B, and KMT5C) to actively repress transcription, maintaining heterochromatin structure, particularly constitutive heterochromatin, and controlling histone H4 'Lys-20' trimethylation. CDK/cyclin-dependent phosphorylation induces Rb dissociation from E2F, activating E2F-responsive genes and triggering S-phase entry. Additionally, Rb promotes the G0-G1 transition upon phosphorylation by CDK3/cyclin-C. In neurons, Rb collaborates with SMARCA4/BRG1 to recruit an HDAC complex, repressing c-FOS promoter transcription; calcium influx triggers calcineurin-mediated Rb dephosphorylation, releasing the repressor complex (By similarity). During viral infection, SV40 large T antigen, HPV E7, or adenovirus E1A disrupts the Rb-E2F1 complex, impairing Rb's function.

Species

Human

Source

E. coli

Tag

C-StrepⅡ

Accession

P06400 (S773-K928)

Gene ID

5925

Protein Length

Partial

Synonyms
Retinoblastoma-associated protein; p105-Rb; p110-RB1; pRb; Rb; pp110; RB1; Homo sapiens; Human; Rb; Chromatin regulator; DNA-binding; Repressor
AA Sequence

STRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

RB1 Protein, Human (StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RB1 Protein, Human (StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RB1 Protein, Human (StrepⅡ)
Cat. No.:
HY-P703588
Quantity:
MCE Japan Authorized Agent: