RBBP4 Protein, Human (sf9, His)

The RBBP4 protein regulates chromatin assembly by binding to core histones and interacting with chromatin assembly factors, remodelers, and histone deacetylases. Its activity is determined by its interaction with nucleosomal DNA. RBBP4 Protein, Human (sf9, His) is the recombinant human-derived RBBP4 protein, expressed by Sf9 insect cells , with N-His labeled tag.

RBBP4 Protein serves as a core histone-binding subunit with a regulatory role in chromatin assembly, acting on chromatin assembly factors, chromatin remodeling factors, and histone deacetylases. Its interactions with nucleosomal DNA govern its activity. Part of various complexes, including CAF-1 for post-replication and repair chromatin assembly, the HDAC complex for transcriptional repression, NuRD for deacetylation and nucleosome remodeling, PRC2 for gene repression, and NURF for chromatin remodeling. It directly binds to histone H4 and plays diverse roles in chromatin regulation, exemplifying its multifaceted involvement in cellular processes.

Human

Sf9 insect cells

N-His

Q09028 (M1-S425)

5928  [NCBI]

Full Length

MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

Approximately 50 kDa

≥ 85%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, 0.5 mM TCEP, 10% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.