1. Recombinant Proteins
  2. Others
  3. RBBP4 Protein, Human (sf9, His)

The RBBP4 protein regulates chromatin assembly by binding to core histones and interacting with chromatin assembly factors, remodelers, and histone deacetylases. Its activity is determined by its interaction with nucleosomal DNA. RBBP4 Protein, Human (sf9, His) is the recombinant human-derived RBBP4 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RBBP4 protein regulates chromatin assembly by binding to core histones and interacting with chromatin assembly factors, remodelers, and histone deacetylases. Its activity is determined by its interaction with nucleosomal DNA. RBBP4 Protein, Human (sf9, His) is the recombinant human-derived RBBP4 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

RBBP4 Protein serves as a core histone-binding subunit with a regulatory role in chromatin assembly, acting on chromatin assembly factors, chromatin remodeling factors, and histone deacetylases. Its interactions with nucleosomal DNA govern its activity. Part of various complexes, including CAF-1 for post-replication and repair chromatin assembly, the HDAC complex for transcriptional repression, NuRD for deacetylation and nucleosome remodeling, PRC2 for gene repression, and NURF for chromatin remodeling. It directly binds to histone H4 and plays diverse roles in chromatin regulation, exemplifying its multifaceted involvement in cellular processes.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

Q09028 (M1-S425)

Gene ID
Molecular Construction
N-term
His
RBBP4 (M1-S425)
Accession # Q09028
C-term
Protein Length

Full Length

Synonyms
Histone-binding protein RBBP4; CAF-I p48; RBBP-4; RBAP48
AA Sequence

MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS

Predicted Molecular Mass
50 kDa
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, 0.5 mM TCEP, 10% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

RBBP4 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RBBP4 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RBBP4 Protein, Human (sf9, His)
Cat. No.:
HY-P74601
Quantity:
MCE Japan Authorized Agent: