RBBP4 Protein, Human (sf9, His)
Based on 1 Customer Validation
The RBBP4 protein regulates chromatin assembly by binding to core histones and interacting with chromatin assembly factors, remodelers, and histone deacetylases. Its activity is determined by its interaction with nucleosomal DNA. RBBP4 Protein, Human (sf9, His) is the recombinant human-derived RBBP4 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The RBBP4 protein regulates chromatin assembly by binding to core histones and interacting with chromatin assembly factors, remodelers, and histone deacetylases. Its activity is determined by its interaction with nucleosomal DNA. RBBP4 Protein, Human (sf9, His) is the recombinant human-derived RBBP4 protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
RBBP4 Protein serves as a core histone-binding subunit with a regulatory role in chromatin assembly, acting on chromatin assembly factors, chromatin remodeling factors, and histone deacetylases. Its interactions with nucleosomal DNA govern its activity. Part of various complexes, including CAF-1 for post-replication and repair chromatin assembly, the HDAC complex for transcriptional repression, NuRD for deacetylation and nucleosome remodeling, PRC2 for gene repression, and NURF for chromatin remodeling. It directly binds to histone H4 and plays diverse roles in chromatin regulation, exemplifying its multifaceted involvement in cellular processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
Q09028 (M1-S425)
-
Molecular Construction
-
N-term
-
His
-
RBBP4 (M1-S425)
Accession # Q09028 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RBBP4; Histone-Binding Protein RBBP4; RB Binding Protein 4, Chromatin Remodeling Factor; CAF-I 48 KDa Subunit; Retinoblastoma-Binding Protein 4; CAF-1 Subunit C; RbAp48; CAF-I P48; NURF55; RBBP-4; Lin-53; Chromatin Assembly Factor/CAF-1 P48 Subunit; Nucle
-
AA Sequence
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDPEGQGS
-
Predicted Molecular Mass
50 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, 0.5 mM TCEP, 10% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
