RBP1 Protein, Human
Based on 1 Customer Validation
RBP1 Protein, a cytoplasmic retinol-binding protein, functions in retinol uptake, storage, and retinoid homeostasis by accepting retinol from the transport protein STRA6. The interaction between RBP1 and STRA6 occurs specifically in the retinol-free apoprotein state. RBP1 Protein, Human is the recombinant human-derived RBP1 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
RBP1 Protein, a cytoplasmic retinol-binding protein, functions in retinol uptake, storage, and retinoid homeostasis by accepting retinol from the transport protein STRA6. The interaction between RBP1 and STRA6 occurs specifically in the retinol-free apoprotein state. RBP1 Protein, Human is the recombinant human-derived RBP1 protein, expressed by E. coli , with tag free.
Background
Retinol-Binding Protein 1 (RBP1) is a cytoplasmic protein involved in retinoid homeostasis, acting as a key player in the uptake and storage of retinol. RBP1 functions by accepting retinol from the transport protein STRA6. In its retinol-free apoprotein state, RBP1 interacts with STRA6, facilitating the transfer of retinol and contributing to the regulation of cellular retinoid levels. These interactions and functions highlight the crucial role of RBP1 in maintaining retinol homeostasis and underscore its significance in cellular processes associated with retinoid metabolism.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P09455 (P2-Q135)
-
Molecular Construction
-
N-term
-
RBP1 (P2-Q135)
Accession # P09455 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RBP1; CRBPI; Retinol Binding Protein 1; RBPC; CRBP1; Retinol-Binding Protein 1, Cellular; CRBP; Cellular Retinol Binding Protein 1; CRABP-I; Cellular Retinol-Binding Protein I; CRBP-I; Retinol-Binding Protein 1; HCRBP1; Cellular Retinol-Binding Protein
-
AA Sequence
PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ
-
Predicted Molecular Mass
15.7 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)