RBP1 Protein, Human

RBP1 Protein, a cytoplasmic retinol-binding protein, functions in retinol uptake, storage, and retinoid homeostasis by accepting retinol from the transport protein STRA6. The interaction between RBP1 and STRA6 occurs specifically in the retinol-free apoprotein state. RBP1 Protein, Human is the recombinant human-derived RBP1 protein, expressed by E. coli , with tag free. The total length of RBP1 Protein, Human is 134 a.a., with molecular weight of ~14.0 kDa.

Retinol-Binding Protein 1 (RBP1) is a cytoplasmic protein involved in retinoid homeostasis, acting as a key player in the uptake and storage of retinol. RBP1 functions by accepting retinol from the transport protein STRA6. In its retinol-free apoprotein state, RBP1 interacts with STRA6, facilitating the transfer of retinol and contributing to the regulation of cellular retinoid levels. These interactions and functions highlight the crucial role of RBP1 in maintaining retinol homeostasis and underscore its significance in cellular processes associated with retinoid metabolism.

Human

E. coli

Tag Free

P09455 (P2-Q135)

5947  [NCBI]

PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.