Copy Link Print Information

RBP4 Protein, Rat (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

RBP4 Protein transports retinol in blood plasma, delivering it from the liver to peripheral tissues. It binds to all-trans retinol, transferring it to STRA6 for cell membrane transport. RBP4 interacts with TTR, preventing kidney filtration, and further aids STRA6 in retinol transport. RBP4 Protein, Rat (HEK293, His) is the recombinant rat-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for RBP4 Protein, Rat (HEK293, His)
  • RBP4 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

RBP4 Protein transports retinol in blood plasma, delivering it from the liver to peripheral tissues. It binds to all-trans retinol, transferring it to STRA6 for cell membrane transport. RBP4 interacts with TTR, preventing kidney filtration, and further aids STRA6 in retinol transport. RBP4 Protein, Rat (HEK293, His) is the recombinant rat-derived RBP4 protein, expressed by HEK293 , with C-His labeled tag.

Background

RBP4 Protein is a retinol-binding protein involved in the transportation of retinol in the blood plasma. It plays a crucial role in delivering retinol from liver stores to peripheral tissues. RBP4 binds to all-trans retinol and transfers it to STRA6, which facilitates the transport of retinol across the cell membrane. RBP4 also interacts with TTR, preventing its filtration through the kidney glomeruli. Additionally, it interacts with STRA6, further contributing to its function in retinol transport.

Verified Bioactivity

Measured by its ability to bind all-trans retinoic acid. The binding of retinoic acid results in the quenching of Trp fluorescence in RBP4. The 50% binding concentration (BC50) is 0.293 μM, as measured under the described conditions.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    P04916 (E19-L201)

  • Gene ID
    25703  [NCBI]
  • Molecular Construction
    • N-term
    • RBP4 (E19-L201)
      Accession # P04916
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    RBP4; Retinol-Binding Protein 4, Interstitial; Retinol Binding Protein 4; Retinol-Binding Protein 4, Plasma; Plasma Retinol-Binding Protein; Retinol Binding Protein 4, Plasma; Retinol-Binding Protein 4; Retinol-Binding Protein; PRBP; MCOPCB10; RBP; RDCCAS

  • AA Sequence

    ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLTPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • RBP4 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for RBP4 Protein, Rat (HEK293, His)
  • RBP4 Protein, Rat (HEK293, His) Product Image