REG-3 beta/REG3B Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

REG-3 beta/REG3B Protein, a bactericidal C-type lectin, combats intestinal Gram-positive and Gram-negative bacteria, except S.typhimurium.It inhibits S.enteritidis translocation, safeguarding against infection.Beyond antibacterial action, REG-3 beta functions hormonally, activating EXTL3 receptor for cell-specific signaling.In the pancreas, it notably stimulates cell proliferation.REG-3 beta/REG3B Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 beta/REG3B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

REG-3 beta/REG3B Protein, a bactericidal C-type lectin, combats intestinal Gram-positive and Gram-negative bacteria, except S.typhimurium.It inhibits S.enteritidis translocation, safeguarding against infection.Beyond antibacterial action, REG-3 beta functions hormonally, activating EXTL3 receptor for cell-specific signaling.In the pancreas, it notably stimulates cell proliferation.REG-3 beta/REG3B Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-3 beta/REG3B protein, expressed by HEK293 , with C-His labeled tag.

Background

REG-3 beta/REG3B, a bactericidal C-type lectin, exhibits antimicrobial properties against various intestinal Gram-positive and Gram-negative bacteria, with the exception of S.typhimurium. Its potential role in protecting against S.enteritidis infection involves inhibiting the translocation of the pathogen from the gut lumen into intestinal and extraintestinal tissues. Beyond its antibacterial function, REG-3 beta acts as a hormone in response to diverse stimuli. When secreted by different cell types, it activates its receptor EXTL3, initiating cell-specific signaling pathways. Notably, in the pancreas, REG-3 beta has the ability to stimulate cell proliferation.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • REG3B (E27-G175)
      Accession # P35230
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    Regenerating islet-derived protein 3-beta; REG-3-beta; Pancreatitis-associated protein 1; Regenerating islet-derived protein III-beta ; Reg III-beta; Regenerating islet-derived protein 3-beta 16.5 kDa form; Regenerating islet-derived protein 3-beta 15 kDa

  • AA Sequence

    EDSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG

  • Predicted Molecular Mass

    18.1 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00