REG-3 gamma/REG3G Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

REG-3 gamma/REG3G protein is a bactericidal C-type lectin that specifically targets Gram-positive bacteria by binding to the peptidoglycan surface moiety, mediating bacterial killing. It limits bacterial colonization of intestinal epithelial surfaces and limits microbiota-induced adaptive immune responses. REG-3 gamma/REG3G Protein, Human (HEK293, His) is the recombinant human-derived REG-3 gamma/REG3G protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

REG-3 gamma/REG3G protein is a bactericidal C-type lectin that specifically targets Gram-positive bacteria by binding to the peptidoglycan surface moiety, mediating bacterial killing. It limits bacterial colonization of intestinal epithelial surfaces and limits microbiota-induced adaptive immune responses. REG-3 gamma/REG3G Protein, Human (HEK293, His) is the recombinant human-derived REG-3 gamma/REG3G protein, expressed by HEK293 , with C-6*His labeled tag.

Background

REG-3 gamma/REG3G Protein, a bactericidal C-type lectin, acts exclusively against Gram-positive bacteria by binding to surface-exposed carbohydrate moieties of peptidoglycan, thereby mediating bacterial killing. This protein restricts bacterial colonization of the intestinal epithelial surface, consequently limiting the activation of adaptive immune responses by the microbiota. It functions as a hormone in response to various stimuli, including anti-inflammatory signals like IL17A or the gut microbiome. REG-3 gamma/REG3G Protein is secreted by different cell types to activate its receptor EXTL3, leading to the induction of cell-specific signaling pathways. In keratinocytes, it is induced by IL17A and regulates keratinocyte proliferation and differentiation following skin injury while inhibiting skin inflammation by suppressing inflammatory cytokines such as IL6 and TNF. In lung epithelial cells, REG-3 gamma/REG3G Protein is induced by IL22, inhibiting cytokine production and regulating allergic airway inflammation. Additionally, it is induced in the small intestine by an inulin-enriched diet and Lactobacillus gasseri-enriched microbiome, contributing to the improvement of gut barrier function, energy balance, and glucose levels. Moreover, REG-3 gamma/REG3G Protein modulates the composition of the microbiota in duodenal contents. Lastly, it is produced by nociceptors in response to endotoxins and prevents endotoxic death by targeting the kynurenine pathway in microglia.

Verified Bioactivity

REG-3 gamma captured on CM5 Sensor Chip can bind Peptidoglycan with an affinity constant of 1.0-5.0 mM as determined in SPR assay.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • REG3G (E27-D175)
      Accession # Q6UW15-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    REG3G; Pancreatitis-Associated Protein IB; Regenerating Family Member 3 Gamma; Reg III-Gamma; PAP1B; REG-3-Gamma; LPPM429; REG III; UNQ429; PAP IB; Regenerating Islet-Derived Protein III-Gamma; PAP-1B; Regenerating Islet-Derived Protein 3-Gamma; Regenerating Gene III; Regenerating Islet-Derived 3 Gamma; REG-III; Pancreatitis-Associated Protein 1B; PAPIB

  • AA Sequence

    EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD

  • Molecular Weight

    Approximately 17-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00