REG-3 alpha/REG3A Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The REG-3 alpha/REG3A protein is a bactericidal C-type lectin that selectively targets Gram-positive bacteria by binding to the peptidoglycan carbohydrate moiety. Its antimicrobial action extends to membrane phospholipid binding, forming pores that help eliminate bacteria. REG-3 alpha/REG3A Protein, Human (HEK293, His) is the recombinant human-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The REG-3 alpha/REG3A protein is a bactericidal C-type lectin that selectively targets Gram-positive bacteria by binding to the peptidoglycan carbohydrate moiety. Its antimicrobial action extends to membrane phospholipid binding, forming pores that help eliminate bacteria. REG-3 alpha/REG3A Protein, Human (HEK293, His) is the recombinant human-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.

Background

REG-3 alpha/REG3A, a bactericidal C-type lectin, exclusively targets Gram-positive bacteria, mediating bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Its antimicrobial action extends to binding membrane phospholipids, forming hexameric membrane-permeabilizing oligomeric pores that contribute to bacterial elimination. Acting as a hormone, REG-3 alpha responds to various stimuli, including anti-inflammatory signals such as IL17A and the gut microbiome. Upon secretion by diverse cell types, REG-3 alpha activates its receptor EXTL3, initiating cell-specific signaling pathways. IL17A-induced REG-3 alpha expression in keratinocytes regulates keratinocyte proliferation and differentiation after skin injury through the activation of the EXTL3-PI3K-AKT signaling pathway. Simultaneously, REG-3 alpha inhibits skin inflammation by suppressing inflammatory cytokines like IL6 and TNF. Notably, in the pancreas, REG-3 alpha permeabilizes beta-cell membranes and stimulates their proliferation.

Verified Bioactivity

Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED50 of this effect is 1-8 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • REG3A (E27-D175)
      Accession # Q06141-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    REG3A; Proliferation-Inducing Protein 42; Prev. PAP; Reg III-Alpha; PAP1; REG-3-Alpha; HIP; HIP/PAP; REG-III; CDNA FLJ76569, Highly Similar To Homo Sapiens Regenerating Islet-Derived 3 Alpha (REG3A), Transcript Variant 1, MRNA; PBCGF; Regenerating Islet-D

  • AA Sequence

    EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00