REG-3 alpha/REG3A Protein, Human (HEK293, His)
Based on 1 Customer Validation
The REG-3 alpha/REG3A protein is a bactericidal C-type lectin that selectively targets Gram-positive bacteria by binding to the peptidoglycan carbohydrate moiety. Its antimicrobial action extends to membrane phospholipid binding, forming pores that help eliminate bacteria. REG-3 alpha/REG3A Protein, Human (HEK293, His) is the recombinant human-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The REG-3 alpha/REG3A protein is a bactericidal C-type lectin that selectively targets Gram-positive bacteria by binding to the peptidoglycan carbohydrate moiety. Its antimicrobial action extends to membrane phospholipid binding, forming pores that help eliminate bacteria. REG-3 alpha/REG3A Protein, Human (HEK293, His) is the recombinant human-derived REG-3 alpha/REG3A protein, expressed by HEK293 , with C-His labeled tag.
Background
REG-3 alpha/REG3A, a bactericidal C-type lectin, exclusively targets Gram-positive bacteria, mediating bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Its antimicrobial action extends to binding membrane phospholipids, forming hexameric membrane-permeabilizing oligomeric pores that contribute to bacterial elimination. Acting as a hormone, REG-3 alpha responds to various stimuli, including anti-inflammatory signals such as IL17A and the gut microbiome. Upon secretion by diverse cell types, REG-3 alpha activates its receptor EXTL3, initiating cell-specific signaling pathways. IL17A-induced REG-3 alpha expression in keratinocytes regulates keratinocyte proliferation and differentiation after skin injury through the activation of the EXTL3-PI3K-AKT signaling pathway. Simultaneously, REG-3 alpha inhibits skin inflammation by suppressing inflammatory cytokines like IL6 and TNF. Notably, in the pancreas, REG-3 alpha permeabilizes beta-cell membranes and stimulates their proliferation.
Verified Bioactivity
Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED50 of this effect is 1-8 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q06141-1 (E27-D175)
-
Molecular Construction
-
N-term
-
REG3A (E27-D175)
Accession # Q06141-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
REG3A; Proliferation-Inducing Protein 42; Prev. PAP; Reg III-Alpha; PAP1; REG-3-Alpha; HIP; HIP/PAP; REG-III; CDNA FLJ76569, Highly Similar To Homo Sapiens Regenerating Islet-Derived 3 Alpha (REG3A), Transcript Variant 1, MRNA; PBCGF; Regenerating Islet-D
-
AA Sequence
EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)