REG-2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
REG-2 Protein potentially inhibits spontaneous calcium carbonate precipitation. REG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-2 protein, expressed by HEK293 , with N-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
REG-2 Protein potentially inhibits spontaneous calcium carbonate precipitation. REG-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived REG-2 protein, expressed by HEK293 , with N-6*His labeled tag.
Background
REG-2 protein may function as an inhibitor of spontaneous calcium carbonate precipitation.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-6*His
-
Accession
Q08731 (Q23-A173)
-
Gene ID19693 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
REG-2 (Q23-A173)
Accession # Q08731 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Lithostathine-2; Islet of Langerhans regenerating protein 2; REG-2; Pancreatic stone protein 2; PSP; Pancreatic thread protein 2; PTP; Reg2
-
AA Sequence
QVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA
-
Predicted Molecular Mass
17.7 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
