REG-2 Protein, Mouse (151a.a, HEK293, His)

REG-2 Protein potentially inhibits spontaneous calcium carbonate precipitation. REG-2 Protein, Mouse (151a.a, HEK293, His) is the recombinant mouse-derived REG-2 protein, expressed by HEK293 , with N-6*His labeled tag. The total length of REG-2 Protein, Mouse (151a.a, HEK293, His) is 151 a.a., with molecular weight of ~16.8 kDa.

REG-2 protein may function as an inhibitor of spontaneous calcium carbonate precipitation.

Mouse

HEK293

N-6*His

Q08731 (Q23-A173)

19693  [NCBI]

QVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA

Approximately 16.8 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.