Renin Protein, Human (HEK293, His)

Renin, a specialized endopeptidase, uniquely converts angiotensinogen to angiotensin I, initiating a cascade that elevates blood pressure and enhances kidney sodium retention. Renin's precision in initiating the angiotensin pathway underscores its pivotal role in regulating blood pressure and electrolyte balance. Renin Protein, Human (HEK293, His) is the recombinant human-derived Renin protein, expressed by HEK293 , with C-10*His labeled tag.

Renin, a specialized endopeptidase, serves a singular function in the conversion of angiotensinogen to angiotensin I within the plasma. This enzymatic activity sets off a series of reactions leading to an increase in blood pressure and enhanced sodium retention by the kidneys. Renin's precision in initiating the angiotensin pathway underscores its pivotal role in regulating blood pressure and electrolyte balance within the body.

Measured by its ability to cleave substrateArg-Glu(EDANS)-Ile-His-Pro-Phe-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Lys(dabcyl)-Arg(HY-P5123A) that Incubate at 37 °C for 1 hour. The specific activity is ≥29.21 pmol/min/μg.

Human

HEK293

C-10*His

P00797-1 (L24-R406)

5972  [NCBI]

Full Length of Isoform-1 Mature Protein (with Propeptide)

LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR

43-50 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 100 mM NaCl, 8% sucrose, 5% mannitol, 0.05% Tween 80, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 5% trehalose, mannitol, 0.01% Tween 80, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.