Renin Protein, Human (HEK293, His)
Based on 1 Customer Validation
Renin, a specialized endopeptidase, uniquely converts angiotensinogen to angiotensin I, initiating a cascade that elevates blood pressure and enhances kidney sodium retention. Renin's precision in initiating the angiotensin pathway underscores its pivotal role in regulating blood pressure and electrolyte balance. Renin Protein, Human (HEK293, His) is the recombinant human-derived Renin protein, expressed by HEK293 , with C-10*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Renin, a specialized endopeptidase, uniquely converts angiotensinogen to angiotensin I, initiating a cascade that elevates blood pressure and enhances kidney sodium retention. Renin's precision in initiating the angiotensin pathway underscores its pivotal role in regulating blood pressure and electrolyte balance. Renin Protein, Human (HEK293, His) is the recombinant human-derived Renin protein, expressed by HEK293 , with C-10*His labeled tag.
Background
Renin, a specialized endopeptidase, serves a singular function in the conversion of angiotensinogen to angiotensin I within the plasma. This enzymatic activity sets off a series of reactions leading to an increase in blood pressure and enhanced sodium retention by the kidneys. Renin's precision in initiating the angiotensin pathway underscores its pivotal role in regulating blood pressure and electrolyte balance within the body.
Verified Bioactivity
Measured by its ability to cleave substrateArg-Glu(EDANS)-Ile-His-Pro-Phe-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Lys(dabcyl)-Arg(HY-P5123A) that Incubate at 37 °C for 1 hour. The specific activity is ≥29.21 pmol/min/μg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
P00797-1 (L24-R406)
-
Molecular Construction
-
N-term
-
Renin (L24-R406)
Accession # P00797-1 -
10*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1 (with Propeptide)
-
Synonyms
REN; Renin Precursor, Renal; Renin; ADTKD4; Angiotensinogenase; HNFJ2; Angiotensin-Forming Enzyme; RTD
-
AA Sequence
LPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
-
Molecular Weight
Approximately 43-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 100 mM NaCl, 8% sucrose, 5% mannitol, 0.05% Tween 80, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 5% trehalose, mannitol, 0.01% Tween 80, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
