1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. RNF11 Protein, Human (His)

The RNF11 protein is an important component of protein complexes that regulate inflammatory signaling pathways. RNF11 Protein, Human (His) is the recombinant human-derived RNF11 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RNF11 protein is an important component of protein complexes that regulate inflammatory signaling pathways. RNF11 Protein, Human (His) is the recombinant human-derived RNF11 protein, expressed by E. coli , with N-6*His labeled tag.

Background

RNF11 takes center stage as an essential component of a ubiquitin-editing protein complex, a collaborative ensemble featuring TNFAIP3, ITCH, and TAX1BP1. This complex operates intricately to orchestrate the transient nature of inflammatory signaling pathways, exerting control over TNF- or LPS-mediated activation of NF-kappa-B. RNF11's role extends to promoting the association of TNFAIP3 with RIPK1 post-TNF stimulation. This, in turn, facilitates TNFAIP3's deubiquitination of 'Lys-63' polyubiquitin chains on RIPK1, initiating the formation of 'Lys-48'-polyubiquitin chains that culminate in RIPK1's proteasomal degradation. Furthermore, RNF11 acts as a recruiter, bringing STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, ultimately resulting in SMURF2's degradation by the 26S proteasome. This intricate web of interactions involves 14-3-3 (when phosphorylated), the E3 ubiquitin-ligases NEDD4, ITCH, SMURF2, and WWP1, as well as the E2 ubiquitin-conjugating enzymes UBE2D1 and UBE2N. Noteworthy associations include those with ZNF350, EPS15, STAMBP, TAX1BP1, TNFAIP3, RIPK1, and GGA1, revealing the multifaceted nature of RNF11's regulatory engagements.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y3C5 (G2-N154)

Gene ID

26994

Molecular Construction
N-term
6*His
RNF11 (G2-N154)
Accession # Q9Y3C5
C-term
Protein Length

Full Length of Mature Protein

Synonyms
RNF11; RING finger protein 11
AA Sequence

GNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RNF11 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RNF11 Protein, Human (His)
Cat. No.:
HY-P701551
Quantity:
MCE Japan Authorized Agent: