RNF11 Protein, Human (His)
The RNF11 protein is an important component of protein complexes that regulate inflammatory signaling pathways. RNF11 Protein, Human (His) is the recombinant human-derived RNF11 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The RNF11 protein is an important component of protein complexes that regulate inflammatory signaling pathways. RNF11 Protein, Human (His) is the recombinant human-derived RNF11 protein, expressed by E. coli , with N-6*His labeled tag.
Background
RNF11 takes center stage as an essential component of a ubiquitin-editing protein complex, a collaborative ensemble featuring TNFAIP3, ITCH, and TAX1BP1. This complex operates intricately to orchestrate the transient nature of inflammatory signaling pathways, exerting control over TNF- or LPS-mediated activation of NF-kappa-B. RNF11's role extends to promoting the association of TNFAIP3 with RIPK1 post-TNF stimulation. This, in turn, facilitates TNFAIP3's deubiquitination of 'Lys-63' polyubiquitin chains on RIPK1, initiating the formation of 'Lys-48'-polyubiquitin chains that culminate in RIPK1's proteasomal degradation. Furthermore, RNF11 acts as a recruiter, bringing STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, ultimately resulting in SMURF2's degradation by the 26S proteasome. This intricate web of interactions involves 14-3-3 (when phosphorylated), the E3 ubiquitin-ligases NEDD4, ITCH, SMURF2, and WWP1, as well as the E2 ubiquitin-conjugating enzymes UBE2D1 and UBE2N. Noteworthy associations include those with ZNF350, EPS15, STAMBP, TAX1BP1, TNFAIP3, RIPK1, and GGA1, revealing the multifaceted nature of RNF11's regulatory engagements.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9Y3C5 (G2-N154)
-
Gene ID26994
-
Molecular Construction
-
N-term
-
6*His
-
RNF11 (G2-N154)
Accession # Q9Y3C5 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
RNF11; MGC51169; Ring Finger Protein 11; RING Finger Protein 11; CGI-123; SID1669; Sid1669p
-
AA Sequence
GNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPVYHPTPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAALLSSYETN
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)