RON/MSPR Protein, Human (HEK293, His, solution)
Based on 1 Customer Validation
RON/MSPR protein is a receptor tyrosine kinase that transduces signals by binding to MST1 ligand and regulates cell survival, migration, and differentiation. Ligand binding induces RON autophosphorylation, creating docking sites for downstream molecules. RON/MSPR Protein, Human (HEK293, His, solution) is the recombinant human-derived RON/MSPR protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RON/MSPR protein is a receptor tyrosine kinase that transduces signals by binding to MST1 ligand and regulates cell survival, migration, and differentiation. Ligand binding induces RON autophosphorylation, creating docking sites for downstream molecules. RON/MSPR Protein, Human (HEK293, His, solution) is the recombinant human-derived RON/MSPR protein, expressed by HEK293 , with C-His labeled tag.
Background
The RON/MSPR protein, a receptor tyrosine kinase, functions as a signal transducer from the extracellular matrix by binding to MST1 ligand. It plays a crucial role in regulating various physiological processes, including cell survival, migration, and differentiation. Ligand binding at the cell surface induces autophosphorylation of RON on its intracellular domain, creating docking sites for downstream signaling molecules. Following activation by ligand, RON interacts with the PI3-kinase subunit PIK3R1, PLCG1, or the adapter GAB1, leading to the activation of multiple signaling cascades, such as RAS-ERK, PI3 kinase-AKT, and PLCgamma-PKC. RON signaling contributes to the wound healing response by promoting epithelial cell migration, proliferation, and survival at the wound site. Additionally, RON plays a role in the innate immune response by regulating the migration and phagocytic activity of macrophages. Alternatively, RON can also promote signals such as cell migration and proliferation in response to growth factors other than MST1 ligand.
Verified Bioactivity
1.This product does not contain protein kinase domain.
2.Measured by its binding ability in a functional ELISA. Immobilized MSP at 0.5 µg/mL (100 µL/well) can bind Biotinylated Recombinant Human RON. The ED50 for this effect is 255.1 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q04912 (E25-L571)
-
Molecular Construction
-
N-term
-
RON (E25-L571)
Accession # Q04912 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
MST1R; S13 Avian Erythroblastosis Oncogene Homolog; Prev. PTK8; C-Met-Related Tyrosine Kinase; Prev. RON; MSP Receptor; Prev. SEA; S13 Erythroblastosis (Avian) Oncogene Homolog; CDw136; S13 Erythroblastosis Oncogene Homolog; Macrophage-Stimulating Protein
-
AA Sequence
EDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKL
-
Predicted Molecular Mass
60 kDa
-
Molecular Weight
Approximately 70 kDa & 37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (239 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)