RXRB Protein, Human
RXRB protein is a receptor for retinoic acid and forms a heterodimer, especially RAR/RXR, which regulates gene expression through the retinoic acid response element (RARE). RXRB exhibits homodimerization and forms heterodimers with other retinoic acid receptor family members. RXRB Protein, Human is the recombinant human-derived RXRB protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
RXRB protein is a receptor for retinoic acid and forms a heterodimer, especially RAR/RXR, which regulates gene expression through the retinoic acid response element (RARE). RXRB exhibits homodimerization and forms heterodimers with other retinoic acid receptor family members. RXRB Protein, Human is the recombinant human-derived RXRB protein, expressed by E. coli , with tag free.
The RXRB Protein functions as the receptor for retinoic acid, forming heterodimers with retinoic acid receptors in response to ligands such as all-trans or 9-cis retinoic acid. These heterodimers, particularly RAR/RXR, play a pivotal role in the regulation of gene expression across diverse biological processes by binding to retinoic acid response elements (RARE). Notably, RXRB exhibits homodimerization in vitro, as reported in studies, and forms heterodimers with other members of the retinoic acid receptor family. Its DNA binding preference is established as a RAR/RXR heterodimer, as documented in research. Furthermore, RXRB interacts with NR1H3 and AKAP13, expanding its associations and suggesting a nuanced involvement in cellular signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P28702 (G294-A528)
-
Gene ID6257
-
Molecular Construction
-
N-term
-
RXRB (G294-A528)
Accession # P28702 -
C-term
-
-
Protein Length
Partial
-
Synonyms
RXRB; Retinoic acid receptor RXR-beta; Nuclear receptor subfamily 2 group B member 2; Retinoid X receptor beta
-
AA Sequence
GAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEA
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
