RXRB Protein, Human

RXRB protein is a receptor for retinoic acid and forms a heterodimer, especially RAR/RXR, which regulates gene expression through the retinoic acid response element (RARE). RXRB exhibits homodimerization and forms heterodimers with other retinoic acid receptor family members. RXRB Protein, Human is the recombinant human-derived RXRB protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RXRB protein is a receptor for retinoic acid and forms a heterodimer, especially RAR/RXR, which regulates gene expression through the retinoic acid response element (RARE). RXRB exhibits homodimerization and forms heterodimers with other retinoic acid receptor family members. RXRB Protein, Human is the recombinant human-derived RXRB protein, expressed by E. coli , with tag free.

Background

The RXRB Protein functions as the receptor for retinoic acid, forming heterodimers with retinoic acid receptors in response to ligands such as all-trans or 9-cis retinoic acid. These heterodimers, particularly RAR/RXR, play a pivotal role in the regulation of gene expression across diverse biological processes by binding to retinoic acid response elements (RARE). Notably, RXRB exhibits homodimerization in vitro, as reported in studies, and forms heterodimers with other members of the retinoic acid receptor family. Its DNA binding preference is established as a RAR/RXR heterodimer, as documented in research. Furthermore, RXRB interacts with NR1H3 and AKAP13, expanding its associations and suggesting a nuanced involvement in cellular signaling pathways.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • RXRB (G294-A528)
      Accession # P28702
    • C-term
  • Protein Length

    Full Length of NR LBD Domain

  • Synonyms

    RXRB; Retinoid X Receptor, Beta; Retinoid X Receptor Beta; MHC Class I Promoter Binding Protein; NR2B2; Retinoid X Receptor Beta Isoform 2; Nuclear Receptor Subfamily 2 Group B Member 2; Retinoid X Receptor Beta Isoform 4; H-2RIIBP; Retinoid X Receptor Be

  • AA Sequence

    GAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEA

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00