1. Recombinant Proteins
  2. Receptor Proteins
  3. Nuclear Receptor Superfamily
  4. RXRB Protein, Human

RXRB protein is a receptor for retinoic acid and forms a heterodimer, especially RAR/RXR, which regulates gene expression through the retinoic acid response element (RARE). RXRB exhibits homodimerization and forms heterodimers with other retinoic acid receptor family members. RXRB Protein, Human is the recombinant human-derived RXRB protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RXRB protein is a receptor for retinoic acid and forms a heterodimer, especially RAR/RXR, which regulates gene expression through the retinoic acid response element (RARE). RXRB exhibits homodimerization and forms heterodimers with other retinoic acid receptor family members. RXRB Protein, Human is the recombinant human-derived RXRB protein, expressed by E. coli , with tag free.

Background

The RXRB Protein functions as the receptor for retinoic acid, forming heterodimers with retinoic acid receptors in response to ligands such as all-trans or 9-cis retinoic acid. These heterodimers, particularly RAR/RXR, play a pivotal role in the regulation of gene expression across diverse biological processes by binding to retinoic acid response elements (RARE). Notably, RXRB exhibits homodimerization in vitro, as reported in studies, and forms heterodimers with other members of the retinoic acid receptor family. Its DNA binding preference is established as a RAR/RXR heterodimer, as documented in research. Furthermore, RXRB interacts with NR1H3 and AKAP13, expanding its associations and suggesting a nuanced involvement in cellular signaling pathways.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P28702 (G294-A528)

Gene ID

6257

Molecular Construction
N-term
RXRB (G294-A528)
Accession # P28702
C-term
Protein Length

Partial

Synonyms
RXRB; Retinoic acid receptor RXR-beta; Nuclear receptor subfamily 2 group B member 2; Retinoid X receptor beta
AA Sequence

GAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEA

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

RXRB Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

RXRB Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RXRB Protein, Human
Cat. No.:
HY-P701402
Quantity:
MCE Japan Authorized Agent: