1. Recombinant Proteins
  2. Others
  3. S100A14 Protein, Human (His)

S100A14 Protein modulates P53/TP53 levels, influencing cell survival and apoptosis. It can either promote cell proliferation or apoptosis and regulates cell migration by modulating MMP2 levels, a P53/TP53-controlled matrix protease. S100A14 does not bind calcium. S100A14 Protein, Human (His) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A14 Protein modulates P53/TP53 levels, influencing cell survival and apoptosis. It can either promote cell proliferation or apoptosis and regulates cell migration by modulating MMP2 levels, a P53/TP53-controlled matrix protease. S100A14 does not bind calcium. S100A14 Protein, Human (His) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag.

Background

S100A14 protein exerts a regulatory influence on cellular processes by modulating P53/TP53 protein levels, thereby contributing to the intricate balance between cell survival and apoptosis. Its functional impact is context-dependent, playing a role in either promoting cell proliferation or apoptosis. Additionally, S100A14 is implicated in the regulation of cell migration through its modulation of MMP2 levels, a matrix protease regulated by P53/TP53 transcriptional control. Notably, S100A14 functions independently of calcium binding and forms homodimers, while also interacting with AGER. This intricate interplay highlights the multifaceted role of S100A14 in cellular dynamics and underscores its potential significance in various physiological contexts.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9HCY8.1 (G2-H104)

Gene ID
Molecular Construction
N-term
His
S100A14 (G2-H104)
Accession # Q9HCY8.1
C-term
Protein Length

Partial

Synonyms
Protein S100-A14; S100 calcium-binding protein A14; S114; S100A14; S100A15
AA Sequence

GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Predicted Molecular Mass
12.6 kDa
Molecular Weight

Approximately 13-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A14 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

S100A14 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A14 Protein, Human (His)
Cat. No.:
HY-P76584
Quantity:
MCE Japan Authorized Agent: