S100A14 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

S100A14 Protein modulates P53/TP53 levels, influencing cell survival and apoptosis. It can either promote cell proliferation or apoptosis and regulates cell migration by modulating MMP2 levels, a P53/TP53-controlled matrix protease. S100A14 does not bind calcium. S100A14 Protein, Human (His) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

S100A14 Protein modulates P53/TP53 levels, influencing cell survival and apoptosis. It can either promote cell proliferation or apoptosis and regulates cell migration by modulating MMP2 levels, a P53/TP53-controlled matrix protease. S100A14 does not bind calcium. S100A14 Protein, Human (His) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag.

Background

S100A14 protein exerts a regulatory influence on cellular processes by modulating P53/TP53 protein levels, thereby contributing to the intricate balance between cell survival and apoptosis. Its functional impact is context-dependent, playing a role in either promoting cell proliferation or apoptosis. Additionally, S100A14 is implicated in the regulation of cell migration through its modulation of MMP2 levels, a matrix protease regulated by P53/TP53 transcriptional control. Notably, S100A14 functions independently of calcium binding and forms homodimers, while also interacting with AGER. This intricate interplay highlights the multifaceted role of S100A14 in cellular dynamics and underscores its potential significance in various physiological contexts.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • S100A14 (G2-H104)
      Accession # Q9HCY8.1
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100A14; Protein S100-A14; S100 Calcium Binding Protein A14; S114; S100A15; Breast Cancer Membrane Protein 84; BCMP84; S100 Calcium-Binding Protein A14

  • AA Sequence

    GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

  • Predicted Molecular Mass

    12.6 kDa

  • Molecular Weight

    Approximately 13-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00