S100A14 Protein, Human (His)
Based on 1 Customer Validation
S100A14 Protein modulates P53/TP53 levels, influencing cell survival and apoptosis. It can either promote cell proliferation or apoptosis and regulates cell migration by modulating MMP2 levels, a P53/TP53-controlled matrix protease. S100A14 does not bind calcium. S100A14 Protein, Human (His) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
S100A14 Protein modulates P53/TP53 levels, influencing cell survival and apoptosis. It can either promote cell proliferation or apoptosis and regulates cell migration by modulating MMP2 levels, a P53/TP53-controlled matrix protease. S100A14 does not bind calcium. S100A14 Protein, Human (His) is the recombinant human-derived S100A14 protein, expressed by E. coli , with N-His labeled tag.
S100A14 protein exerts a regulatory influence on cellular processes by modulating P53/TP53 protein levels, thereby contributing to the intricate balance between cell survival and apoptosis. Its functional impact is context-dependent, playing a role in either promoting cell proliferation or apoptosis. Additionally, S100A14 is implicated in the regulation of cell migration through its modulation of MMP2 levels, a matrix protease regulated by P53/TP53 transcriptional control. Notably, S100A14 functions independently of calcium binding and forms homodimers, while also interacting with AGER. This intricate interplay highlights the multifaceted role of S100A14 in cellular dynamics and underscores its potential significance in various physiological contexts.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9HCY8.1 (G2-H104)
-
Molecular Construction
-
N-term
-
His
-
S100A14 (G2-H104)
Accession # Q9HCY8.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
S100A14; Protein S100-A14; S100 Calcium Binding Protein A14; S114; S100A15; Breast Cancer Membrane Protein 84; BCMP84; S100 Calcium-Binding Protein A14
-
AA Sequence
GQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
-
Predicted Molecular Mass
12.6 kDa
-
Molecular Weight
Approximately 13-13 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
