S100A3 Protein, Human (His-MBP)
Based on 1 Customer Validation
S100A3 Protein, functioning as a monomer, displays a robust binding affinity for calcium and zinc. It is implicated in calcium-dependent cuticle cell differentiation and contributes to the formation of the hair shaft and hair cuticular barrier. In its citrullinated state, S100A3 can exist as both a homodimer and a homotetramer, indicating potential involvement in various cellular processes associated with these forms. S100A3 Protein, Human (His-MBP) is the recombinant human-derived S100A3 protein, expressed by E. coli , with N-His, N-MBP labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
S100A3 Protein, functioning as a monomer, displays a robust binding affinity for calcium and zinc. It is implicated in calcium-dependent cuticle cell differentiation and contributes to the formation of the hair shaft and hair cuticular barrier. In its citrullinated state, S100A3 can exist as both a homodimer and a homotetramer, indicating potential involvement in various cellular processes associated with these forms. S100A3 Protein, Human (His-MBP) is the recombinant human-derived S100A3 protein, expressed by E. coli , with N-His, N-MBP labeled tag.
Background
S100A3, a protein with the ability to bind both calcium and zinc, emerges as a potential player in calcium-dependent cuticle cell differentiation and the formation of hair shafts and cuticular barriers. Its binding affinity for calcium and zinc suggests a regulatory role in cellular processes dependent on these ions. The protein is known to exist in homodimer and homotetramer forms, particularly in its citrullinated state, indicating a potential structural significance in its functional activity. The implication of S100A3 in processes related to hair development and barrier formation underscores its importance in the molecular mechanisms governing tissue differentiation and integrity.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-MBP
-
Accession
P33764 (M1-Q101)
-
Molecular Construction
-
N-term
-
His-MBP
-
S100A3 (M1-Q101)
Accession # P33764 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A3; S100 Calcium-Binding Protein A3; Prev. S100E; Protein S-100E; S100 Calcium Binding Protein A3; Protein S100-A3
-
AA Sequence
MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
-
Predicted Molecular Mass
55.3 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 20% glycerol, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
