1. Recombinant Proteins
  2. Others
  3. S100A3 Protein, Human (His-MBP)

S100A3 Protein, functioning as a monomer, displays a robust binding affinity for calcium and zinc. It is implicated in calcium-dependent cuticle cell differentiation and contributes to the formation of the hair shaft and hair cuticular barrier. In its citrullinated state, S100A3 can exist as both a homodimer and a homotetramer, indicating potential involvement in various cellular processes associated with these forms. S100A3 Protein, Human (His-MBP) is the recombinant human-derived S100A3 protein, expressed by E. coli , with N-His, N-MBP labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A3 Protein, functioning as a monomer, displays a robust binding affinity for calcium and zinc. It is implicated in calcium-dependent cuticle cell differentiation and contributes to the formation of the hair shaft and hair cuticular barrier. In its citrullinated state, S100A3 can exist as both a homodimer and a homotetramer, indicating potential involvement in various cellular processes associated with these forms. S100A3 Protein, Human (His-MBP) is the recombinant human-derived S100A3 protein, expressed by E. coli , with N-His, N-MBP labeled tag.

Background

S100A3, a protein with the ability to bind both calcium and zinc, emerges as a potential player in calcium-dependent cuticle cell differentiation and the formation of hair shafts and cuticular barriers. Its binding affinity for calcium and zinc suggests a regulatory role in cellular processes dependent on these ions. The protein is known to exist in homodimer and homotetramer forms, particularly in its citrullinated state, indicating a potential structural significance in its functional activity. The implication of S100A3 in processes related to hair development and barrier formation underscores its importance in the molecular mechanisms governing tissue differentiation and integrity.

Species

Human

Source

E. coli

Tag

N-His;N-MBP

Accession

P33764 (M1-Q101)

Gene ID
Molecular Construction
N-term
His-MBP
S100A3 (M1-Q101)
Accession # P33764
C-term
Protein Length

Full Length

Synonyms
Protein S100-A3; Protein S-100E; S100 calcium-binding protein A3; S100E
AA Sequence

MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Molecular Weight

Approximately 50 kDa

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 20% glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

S100A3 Protein, Human (His-MBP) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

S100A3 Protein, Human (His-MBP)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A3 Protein, Human (His-MBP)
Cat. No.:
HY-P76585
Quantity:
MCE Japan Authorized Agent: