S100A8 Protein, Human (sf9, His)
S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8 Protein, Human (sf9, His) is the recombinant human-derived S100A8 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
S100A8 consists of calcium and zinc bound S100A8, which plays a critical regulatory role in inflammation and immune responses. As calprotectin, it contributes to leukocyte function, regulates the cytoskeleton, and activates intracellular NADPH oxidase. S100A8 Protein, Human (sf9, His) is the recombinant human-derived S100A8 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
The S100A8, consisting of calcium- and zinc-binding S100A8, plays a crucial role in regulating inflammatory processes and immune responses. Often found as calprotectin (S100A8/A9), it serves diverse intracellular functions, including facilitating leukocyte arachidonic acid trafficking and metabolism, modulating the tubulin-dependent cytoskeleton during phagocyte migration, and activating the neutrophilic NADPH-oxidase. In particular, it activates NADPH-oxidase by aiding in the assembly of the enzyme complex at the cell membrane, transferring arachidonic acid, and directly binding to NCF2/P67PHOX. Extracellularly, it exhibits pro-inflammatory, antimicrobial, oxidant-scavenging, and apoptosis-inducing activities. Acting as an alarmin or danger-associated molecular pattern (DAMP) molecule, S100A8 stimulates innate immune cells through binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER), activating MAP-kinase and NF-kappa-B signaling pathways and amplifying the pro-inflammatory cascade. With antimicrobial activity against bacteria and fungi, it likely exerts this effect through Zn(2+) chelation essential for microbial growth. Additionally, S100A8/A9 induces cell death via autophagy and apoptosis, regulates neutrophil number and apoptosis, and acts as an oxidant scavenger to prevent tissue damage. Its role as an amplifier of inflammation in autoimmunity and cancer development is notable, and in microbial infection, such as by SARS-CoV-2, it may induce expansion of aberrant immature neutrophils in a TLR4-dependent manner.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P05109 (M1-E93)
-
Molecular Construction
-
N-term
-
S100A8 (M1-E93)
Accession # P05109 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
S100A8; MRP-8; Prev. CAGA; Urinary Stone Protein Band A; Prev. CFAG; Protein S100-A8; MRP8; Calgranulin A; P8; S100 Calcium-Binding Protein A8; Migration Inhibitory Factor-Related Protein 8; Calgranulin-A; Leukocyte L1 Complex Light Chain; CP-10; Calprote
-
AA Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
-
Predicted Molecular Mass
12.2 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)