SAG Protein, Human (P.pastoris, His)

SAG proteins play a crucial role in phototransduction, regulating signal transduction by binding to light-activated and phosphorylated rhodopsin (RHO). It terminates RHO signaling by competitively interacting with G proteins at the same binding site on RHO. SAG Protein, Human (P.pastoris, His) is the recombinant human-derived SAG protein, expressed by P. pastoris , with N-6*His labeled tag.

The SAG protein exhibits a crucial regulatory role in phototransduction by binding to photoactivated and phosphorylated rhodopsin (RHO), thereby terminating RHO signaling via G-proteins. Through competitive interaction with G-proteins for the same binding site on RHO, SAG effectively modulates signal transduction in a manner consistent with similar proteins. Moreover, SAG may contribute to preventing light-dependent degeneration of retinal photoreceptor cells, as suggested by research findings. Structurally, SAG can exist as a monomer, homodimer, or homotetramer, highlighting its versatile oligomeric states. Furthermore, SAG engages in specific interactions with RHO, specifically binding to the phosphorylated C-terminus, elucidating its intricate involvement in the molecular dynamics of photoreceptor cells.

Human

P. pastoris

N-6*His

P10523 (M1-E405)

6295  [NCBI]

Full Length

MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE

Approximately 47.1 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm filtered solution of PBS,6% Trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.