SAG Protein, Human (P.pastoris, His)
Based on 1 Customer Validation
SAG proteins play a crucial role in phototransduction, regulating signal transduction by binding to light-activated and phosphorylated rhodopsin (RHO). It terminates RHO signaling by competitively interacting with G proteins at the same binding site on RHO. SAG Protein, Human (P.pastoris, His) is the recombinant human-derived SAG protein, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SAG proteins play a crucial role in phototransduction, regulating signal transduction by binding to light-activated and phosphorylated rhodopsin (RHO). It terminates RHO signaling by competitively interacting with G proteins at the same binding site on RHO. SAG Protein, Human (P.pastoris, His) is the recombinant human-derived SAG protein, expressed by P. pastoris , with N-6*His labeled tag.
Background
The SAG protein exhibits a crucial regulatory role in phototransduction by binding to photoactivated and phosphorylated rhodopsin (RHO), thereby terminating RHO signaling via G-proteins. Through competitive interaction with G-proteins for the same binding site on RHO, SAG effectively modulates signal transduction in a manner consistent with similar proteins. Moreover, SAG may contribute to preventing light-dependent degeneration of retinal photoreceptor cells, as suggested by research findings. Structurally, SAG can exist as a monomer, homodimer, or homotetramer, highlighting its versatile oligomeric states. Furthermore, SAG engages in specific interactions with RHO, specifically binding to the phosphorylated C-terminus, elucidating its intricate involvement in the molecular dynamics of photoreceptor cells.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-6*His
-
Accession
P10523 (M1-E405)
-
Molecular Construction
-
N-term
-
6*His
-
SAG (M1-E405)
Accession # P10523 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SAG; Retinal S-Antigen; S-Antigen Visual Arrestin; Rod Arrestin; Rod Photoreceptor Arrestin; Arrestin 1; 48 KDa Protein; ARRESTIN; S-Arrestin; S-AG; RP47; Retinal S-Antigen (48 KDa Protein); S-Antigen; Retina And Pineal Gland (Arrestin); RP96
-
AA Sequence
MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE
-
Predicted Molecular Mass
47.1 kDa
-
Molecular Weight
Approximately 47 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
