Syndecan-2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Syndecan-2 Protein is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. Syndecan-2 functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Syndecan-2 is necessary for tumor angiogenesis that facilitates tumor growth and metastasis. Syndecan-2 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Syndecan-2 Protein is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. Syndecan-2 functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Syndecan-2 is necessary for tumor angiogenesis that facilitates tumor growth and metastasis. Syndecan-2 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Syndecan-2 is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. Syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. Syndecan-2 functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Increased expression of Syndecan-2 may directly relate to loss of cell/substrate interactions and contact inhibition and contribute to both the tumorigenic and metastatic potential in cancer cells. Syndecan-2 is necessary for tumor angiogenesis that facilitates tumor growth and metastasis. Syndecan-2 is a novel marker of hematopoietic stem cell (HSC) that regulates HSC repopulating capacity through control of expression of Cdkn1c (p57) and HSC quiescence. In addition, Syndecan-2 inhibits α-SMA expression, cell contraction, proliferation, and migration induced by TGF-β1 in mouse lung fibroblasts[1][2][3].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Syndecan-2 (E19-E144)
      Accession # AAH49836.1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SDC2; Heparan Sulfate Proteoglycan 1, Cell Surface-Associated; Prev. HSPG1; Syndecan Proteoglycan 2; Prev. HSPG; Syndecan-2; Fibroglycan; Cell Surface-Associated Heparan Sulfate Proteoglycan 1; SYND2; CD362 Antigen; CD362; Syndecan; Syndecan 2; Heparan Su

  • AA Sequence

    ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE

  • Predicted Molecular Mass

    15 kDa

  • Molecular Weight

    Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00