Syndecan-2 Protein, Human (HEK293, His)

Syndecan-2 Protein is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. Syndecan-2 functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Syndecan-2 is necessary for tumor angiogenesis that facilitates tumor growth and metastasis. Syndecan-2 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Syndecan-2 Protein, Human (HEK293, His) is 126 a.a., with molecular weight of 25-40 kDa.

Syndecan-2 is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. Syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. Syndecan-2 functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Increased expression of Syndecan-2 may directly relate to loss of cell/substrate interactions and contact inhibition and contribute to both the tumorigenic and metastatic potential in cancer cells. Syndecan-2 is necessary for tumor angiogenesis that facilitates tumor growth and metastasis. Syndecan-2 is a novel marker of hematopoietic stem cell (HSC) that regulates HSC repopulating capacity through control of expression of Cdkn1c (p57) and HSC quiescence. In addition, Syndecan-2 inhibits α-SMA expression, cell contraction, proliferation, and migration induced by TGF-β1 in mouse lung fibroblasts^[1][2][3].

Human

HEK293

C-6*His

AAH49836.1 (E19-E144)

6383  [NCBI]

ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE

25-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.