Copy Link Print Information

SDC4 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

SDC4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to regulate exosome biogenesis.SDC4 exists as a homodimer and engages in important interactions with various intracellular partners.SDC4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SDC4 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for SDC4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for SDC4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for SDC4 Protein, Mouse (HEK293, His)
  • SDC4 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SDC4 protein is a cell surface proteoglycan that cooperates with SDCBP and PDCD6IP to regulate exosome biogenesis.SDC4 exists as a homodimer and engages in important interactions with various intracellular partners.SDC4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SDC4 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Syndecan-4 (SDC4) is a cell surface proteoglycan that plays a crucial role in regulating exosome biogenesis in collaboration with SDCBP and PDCD6IP. As a homodimer, SDC4 engages in various protein interactions, including binding with CDCP1 and SDCBP, suggesting its involvement in diverse cellular processes. Through its cytoplasmic domain, SDC4 forms interactions with GIPC, specifically through the PDZ domain, and with NUDT16L1. These associations highlight the multifunctional nature of SDC4, suggesting its participation in intricate cellular signaling pathways and the regulation of exosome dynamics.

Verified Bioactivity

1. Measured by the ability of the immobilized protein to support the adhesion of A431 human epithelial carcinoma cells. When 5 x 104 cells/well are added to mouse SDC4 and human Fibronectin (0.5 μg/mL) coated plates, cell adhesion is enhanced in a dose dependent manner after 45 minutes at 37 °C. The ED50 for this effect is 1.52 μg/mL, corresponding to a specific activity is 657.895 U/mg.
2. Measured by its binding ability in a functional ELISA. Immobilized Mouse MDK (HY-P79419) at 10 μg/mL (100 μL/well) can bind Mouse SDC4. The ED50 for this effect is 1.121 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of A431 human epithelial carcinoma cells. When 5 x 104 cells/well are added to mouse SDC4 and human Fibronectin (0.5 μg/mL) coated plates, cell adhesion is enhanced in a dose dependent manner after 45 minutes at 37 °C. The ED50 for this effect is 1.52 μg/mL, corresponding to a specific activity is 657.895 U/mg.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Mouse MDK (HY-P79419) at 10 μg/mL (100 μL/well) can bind Mouse SDC4. The ED50 for this effect is 1.121 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    O35988 (E24-E145)

  • Gene ID
    20971  [NCBI]
  • Molecular Construction
    • N-term
    • SDC4 (E24-E145)
      Accession # O35988
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SDC4; Ryudocan Core Protein; Syndecan 4; Syndecan-4; Amphiglycan; Ryudocan; SYND4; Ryudocan Amphiglycan; Syndecan 4 (Amphiglycan, Ryudocan); Syndecan; Syndecan Proteoglycan 4

  • AA Sequence

    ESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTE

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by the ability of the immobilized protein to support the adhesion of A431 human epithelial carcinoma cells. When 5 x 104 cells/well are added to mouse SDC4 and human Fibronectin (0.5 μg/mL) coated plates, cell adhesion is enhanced in a dose dependent manner after 45 minutes at 37 °C. The ED50 for this effect is 1.52 μg/mL, corresponding to a specific activity is 657.895 U/mg.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Mouse MDK (HY-P79419) at 10 μg/mL (100 μL/well) can bind Mouse SDC4. The ED50 for this effect is 1.121 μg/mL.

  • SDC4 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for SDC4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for SDC4 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for SDC4 Protein, Mouse (HEK293, His)
  • SDC4 Protein, Mouse (HEK293, His) Product Image