1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. SDF-2 Protein, Human (sf9, His)

SDF-2 Protein is part of the family of proteins involved in the activation of ER stress/UPR. SDF2 protein is believed to be a secretory protein. SDF-2 Protein, Human (sf9, His) is the recombinant human-derived SDF-2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SDF-2 Protein is part of the family of proteins involved in the activation of ER stress/UPR. SDF2 protein is believed to be a secretory protein. SDF-2 Protein, Human (sf9, His) is the recombinant human-derived SDF-2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

SDF-2 Protein is part of the family of proteins involved in the activation of ER stress/UPR. SDF2 Protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q6IBU4 (S19-L211)

Gene ID
Molecular Construction
N-term
SDF-2 (S19-L211)
Accession # Q6IBU4
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Stromal cell-derived factor 2; SDF2
AA Sequence

SSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL

Predicted Molecular Mass
22.7 kDa
Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SDF-2 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SDF-2 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SDF-2 Protein, Human (sf9, His)
Cat. No.:
HY-P76054
Quantity:
MCE Japan Authorized Agent: