SDF-2 Protein, Human (sf9, His)
SDF-2 Protein is part of the family of proteins involved in the activation of ER stress/UPR. SDF2 protein is believed to be a secretory protein. SDF-2 Protein, Human (sf9, His) is the recombinant human-derived SDF-2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SDF-2 Protein is part of the family of proteins involved in the activation of ER stress/UPR. SDF2 protein is believed to be a secretory protein. SDF-2 Protein, Human (sf9, His) is the recombinant human-derived SDF-2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
SDF-2 Protein is part of the family of proteins involved in the activation of ER stress/UPR. SDF2 Protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q6IBU4 (S19-L211)
-
Molecular Construction
-
N-term
-
SDF-2 (S19-L211)
Accession # Q6IBU4 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
SDF2; SDF-2; Stromal Cell Derived Factor 2; SDF2 Protein; Stromal Cell-Derived Factor 2
-
AA Sequence
SSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL
-
Predicted Molecular Mass
22.7 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)