Serpin A1a Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Serpin A1a Protein, Mouse (HEK 293, His) is the recombinant mouse-derived Serpin A1a, expressed by HEK293 , with C-6*His labeled tag. ,
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Serpin A1a Protein, Mouse (HEK 293, His) is the recombinant mouse-derived Serpin A1a, expressed by HEK293 , with C-6*His labeled tag. ,
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
AAH11040.1 (E25-K413)
-
Molecular Construction
-
N-term
-
Serpin A1a (E25-K413)
Accession # AAH11040.1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Alpha-1-antitrypsin 1-5 Chain
-
Synonyms
Alpha-1-antitrypsin 1-1; AAT; Alpha-1 protease inhibitor 1; Alpha-1-antiproteinase; Serine protease inhibitor 1-1; Serine protease inhibitor A1a; Serpin A1a; Serpina1a; Dom1; Spi1-1
-
AA Sequence
EDVQETDTSQKDQSPASHEIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGKIAEAVKKLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVFLLPDDGKMQHLEQTLSKELISKFLLNRRRRLAQIHFPRLSISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQMVPMSMPPILRFDHPFLFIIFEEHTQSPIFVGKVVDPTHK
-
Predicted Molecular Mass
44.3 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (234 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
