Copy Link Print Information

SFRP1 Protein, Mouse (CHO, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

SFRP1 Protein is a secreted glycoprotein member of the SFRP family.SFRP1 Protein can act as an inhibitor of Wnt signaling and is capable of resisting vascular cell proliferation.SFRP1 Protein, Mouse (CHO, His) is the recombinant mouse-derived SFRP1 protein, expressed by CHO , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • SFRP1 Protein, Mouse (CHO, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SFRP1 Protein is a secreted glycoprotein member of the SFRP family.SFRP1 Protein can act as an inhibitor of Wnt signaling and is capable of resisting vascular cell proliferation.SFRP1 Protein, Mouse (CHO, His) is the recombinant mouse-derived SFRP1 protein, expressed by CHO , with C-10*His labeled tag.

Background

SFRP1 protein is an inhibitor of Wnt signaling, which can inhibit WNT1/WNT4-mediated TCF-dependent transcription. SFRP1 protein can reduce intracellular beta-catenin levels.SFRP1 Protein has anti-proliferative effects on vascular cells in vitro and in vivo, and can induce angiogenesis in vivo. In the vascular cell cycle, SFRP1 Protein delays the G1 phase and enters the S phase. In kidney development, SFRP1 Protein inhibits the formation of posterior renal tubules and the growth of buds. SFRP1 Protein plays a key role in maintaining the function of hematopoietic stem cells (HSC). SFRP1 Protein is a multifunctional regulator of intercellular communication, and can be used as a potential target for treating chronic inflammation in neurodegenerative diseases[1][2]

Verified Bioactivity

Measured by its ability to inhibit Topflash reporter activity in HEK293T human embryonic kidney cells. The ED50 for this effect is typically 0.4-2 μg/mL in the presence of 300 ng/mL of Recombinant Mouse Wnt-3a.

Technical Parameters

  • Species Mouse
  • Source CHO
  • Tag C-10*His
  • Accession

    AAC53145.1 (S32-K314)

  • Gene ID
    20377  [NCBI]
  • Molecular Construction
    • N-term
    • SFRP1 (S32-K314)
      Accession # AAC53145.1
    • 10*His
    • C-term
  • Protein Length

    Full Length of Secreted frizzled-related protein 1 Chain

  • Synonyms

    SFRP1; SARP-2; Secreted Frizzled Related Protein 1; SFRP-1; SARP2; FRP1; FRP-1; Frizzled-Related Protein; FRP; SFRP1 Protein; Secreted Frizzled-Related Protein 1; FrzA; Secreted Apoptosis-Related Protein 2

  • AA Sequence

    SEYDYVSFQSDIGSYQSGRFYTKPPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKALVLFLKNGADCPCHQLDNLSHNFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKRMKNHECPTFQSVFK

  • Predicted Molecular Mass

    32.6 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SFRP1 Protein, Mouse (CHO, His) Product Image
    1/16
  • SFRP1 Protein, Mouse (CHO, His) Product Image