Copy Link Print Information

SFRP4 Protein, Human (CHO, His)

Customer Review

Based on 1 Customer Validation

The SFRP4 protein is a member of the soluble Frizzled-related protein (sFRP) and regulates Wnt signaling by directly interacting with Wnt. It has similar functions to other sFRPs and contributes to the regulation of cell growth and differentiation in specific cell types. SFRP4 Protein, Human (CHO, His) is the recombinant human-derived SFRP4 protein, expressed by CHO , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • SFRP4 Protein, Human (CHO, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The SFRP4 protein is a member of the soluble Frizzled-related protein (sFRP) and regulates Wnt signaling by directly interacting with Wnt. It has similar functions to other sFRPs and contributes to the regulation of cell growth and differentiation in specific cell types. SFRP4 Protein, Human (CHO, His) is the recombinant human-derived SFRP4 protein, expressed by CHO , with C-His labeled tag.

Background

SFRP4, a member of the soluble frizzled-related proteins (sFRPs), serves as a modulator of Wnt signaling through its direct interaction with Wnts. Demonstrating functional similarities to other sFRPs, SFRP4 contributes to the regulation of cell growth and differentiation in specific cell types. Notably, it plays a crucial role in bone morphogenesis and may act as a regulator of adult uterine morphology and function. Additionally, SFRP4 is implicated in increasing apoptosis during ovulation, potentially through the modulation of FZ1/FZ4/WNT4 signaling. Furthermore, it exhibits phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake. These diverse functions underscore the versatile regulatory role of SFRP4 in various cellular processes and physiological contexts.

Verified Bioactivity

Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T 1/2 2A6 mouse embryonal fibroblast cells. The ED50 for this effect is typically 2-20 μg/mL in the presence of 20 ng/mL of Wnt3a.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag C-His
  • Accession

    Q6FHJ7 (A22-V346)

  • Gene ID
    6424  [NCBI]
  • Molecular Construction
    • N-term
    • SFRP4 (M18-V346)
      Accession # Q6FHJ7
    • His
    • C-term
  • Protein Length

    Full Length of Secreted frizzled-related protein 4 Chain

  • Synonyms

    SFRP4; Frizzled Protein, Human Endometrium; Secreted Frizzled Related Protein 4; SFRP-4; FrpHE; Secreted Frizzled-Related Protein 4; Secreted Frizzled-Related Protein 4; Secreted Frizzled-Related Protein 4; FRPHE; FRZB-2; PYL; FRP-4

  • AA Sequence

    APCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV

  • Predicted Molecular Mass

    39 kDa

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SFRP4 Protein, Human (CHO, His) Product Image
    1/16
  • SFRP4 Protein, Human (CHO, His) Product Image