Siglec-10 Protein, Mouse (HEK293, His)

Siglec-10 protein is an adhesion molecule that mediates sialic acid-dependent cell binding, preferentially selecting α-2,3- or α-2,6-linked sialic acid. Its sialic acid recognition site may be masked through cis interactions. Siglec-10, Mouse (HEK293, His) is the recombinant mouse-derived Siglec-10 protein, expressed by HEK293, with C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Siglec-10 protein is an adhesion molecule that mediates sialic acid-dependent cell binding, preferentially selecting α-2,3- or α-2,6-linked sialic acid. Its sialic acid recognition site may be masked through cis interactions. Siglec-10, Mouse (HEK293, His) is the recombinant mouse-derived Siglec-10 protein, expressed by HEK293, with C-mFc labeled tag.

Background

Siglec-10 Protein, identified as a putative adhesion molecule, serves as a mediator of sialic-acid-dependent binding to cells, with a preference for alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may undergo masking through cis interactions with sialic acids on the same cell surface. In the immune response, Siglec-10 functions as an inhibitory receptor, achieving ligand-induced tyrosine phosphorylation and recruiting cytoplasmic phosphatases via their SH2 domains to block signal transduction through the dephosphorylation of signaling molecules. Notably, it participates in the negative regulation of B-cell antigen receptor signaling, specifically acting on B1 cells to inhibit Ca(2+) signaling, cellular expansion, and antibody secretion. This inhibition is dependent on PTPN6/SHP-1. Siglec-10, in association with CD24, may be involved in selectively suppressing the immune response to danger-associated molecular patterns (DAMPs) and regulating the immune response of natural killer (NK) cells. Furthermore, it plays a role in controlling autoimmunity and, during the initiation of adaptive immune responses by CD8-alpha(+) dendritic cells, inhibits cross-presentation by impairing the formation of MHC class I-peptide complexes. Additionally, in the context of microbial infection by RNA viruses, Siglec-10 inhibits RIG-I signaling in macrophages by promoting its CBL-dependent ubiquitination and degradation via PTPN11/SHP-2. The multifaceted roles of Siglec-10 highlight its intricate involvement in diverse cellular processes and immune modulation.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Siglec-10 (Q18-K543)
      Accession # Q80ZE3
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SIGLEC10; Siglec-Like Protein 2; Sialic Acid Binding Ig Like Lectin 10; Siglec-Like Gene 2; SLG2; MGC126774; SIGLEC-10; Sialic Acid Binding Ig-Like Lectin 10; PRO940; SIGLEC10 Protein; Sialic Acid Binding Ig-Like Lectin 10 Ig-Like Lectin 7; Siglec-10; Sia

  • AA Sequence

    QMESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSK

  • Predicted Molecular Mass

    60.7 kDa

  • Molecular Weight

    Approximately 40 kDa & 50 kDa & 75-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00