Siglec-10 Protein, Mouse (HEK293, His)
Siglec-10 protein is an adhesion molecule that mediates sialic acid-dependent cell binding, preferentially selecting α-2,3- or α-2,6-linked sialic acid. Its sialic acid recognition site may be masked through cis interactions. Siglec-10, Mouse (HEK293, His) is the recombinant mouse-derived Siglec-10 protein, expressed by HEK293, with C-mFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Siglec-10 protein is an adhesion molecule that mediates sialic acid-dependent cell binding, preferentially selecting α-2,3- or α-2,6-linked sialic acid. Its sialic acid recognition site may be masked through cis interactions. Siglec-10, Mouse (HEK293, His) is the recombinant mouse-derived Siglec-10 protein, expressed by HEK293, with C-mFc labeled tag.
Background
Siglec-10 Protein, identified as a putative adhesion molecule, serves as a mediator of sialic-acid-dependent binding to cells, with a preference for alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may undergo masking through cis interactions with sialic acids on the same cell surface. In the immune response, Siglec-10 functions as an inhibitory receptor, achieving ligand-induced tyrosine phosphorylation and recruiting cytoplasmic phosphatases via their SH2 domains to block signal transduction through the dephosphorylation of signaling molecules. Notably, it participates in the negative regulation of B-cell antigen receptor signaling, specifically acting on B1 cells to inhibit Ca(2+) signaling, cellular expansion, and antibody secretion. This inhibition is dependent on PTPN6/SHP-1. Siglec-10, in association with CD24, may be involved in selectively suppressing the immune response to danger-associated molecular patterns (DAMPs) and regulating the immune response of natural killer (NK) cells. Furthermore, it plays a role in controlling autoimmunity and, during the initiation of adaptive immune responses by CD8-alpha(+) dendritic cells, inhibits cross-presentation by impairing the formation of MHC class I-peptide complexes. Additionally, in the context of microbial infection by RNA viruses, Siglec-10 inhibits RIG-I signaling in macrophages by promoting its CBL-dependent ubiquitination and degradation via PTPN11/SHP-2. The multifaceted roles of Siglec-10 highlight its intricate involvement in diverse cellular processes and immune modulation.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q80ZE3 (Q18-K543)
-
Gene ID243958
-
Molecular Construction
-
N-term
-
Siglec-10 (Q18-K543)
Accession # Q80ZE3 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SIGLEC10; Siglec-Like Protein 2; Sialic Acid Binding Ig Like Lectin 10; Siglec-Like Gene 2; SLG2; MGC126774; SIGLEC-10; Sialic Acid Binding Ig-Like Lectin 10; PRO940; SIGLEC10 Protein; Sialic Acid Binding Ig-Like Lectin 10 Ig-Like Lectin 7; Siglec-10; Sia
-
AA Sequence
QMESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSK
-
Predicted Molecular Mass
60.7 kDa
-
Molecular Weight
Approximately 40 kDa & 50 kDa & 75-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)