Siglec-15 Protein, Human (HEK293, His-Avi)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, His-Avi) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

The Siglec-15 Protein plays a crucial role in cellular interactions by selectively binding to sialylated glycoproteins, indicating a specific affinity for molecules with sialic acid residues. Additionally, Siglec-15 engages in molecular associations with TYROBP and HCST, suggesting its involvement in intricate signaling pathways. This ability to interact with key signaling partners underscores Siglec-15's potential significance in mediating immune responses and cellular communication. The specific recognition of sialylated glycoproteins highlights the protein's role in recognizing and responding to cell surface modifications, contributing to the complex network of cellular interactions.

Human

HEK293

C-Avi;C-8*His

Q6ZMC9-1 (F20-T263)

284266  [NCBI]

Extracellular Domain

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Approximately 30-38 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.