SINHCAF Protein, Human (GST)

SINHCAF is a key subunit of the Sin3 deacetylase complex (Sin3/HDAC) and is essential for inhibiting genes related to the TGF-β signaling pathway. In embryonic stem (ES) cells, SINHCAF forms the SIN3A complex together with SIN3A, HDAC1, SAP30, RBBP4, OGT, and TET1. SINHCAF Protein, Human (GST) is the recombinant human-derived SINHCAF protein, expressed by E. coli , with N-GST labeled tag. The total length of SINHCAF Protein, Human (GST) is 221 a.a., with molecular weight of 51.9 kDa.

SINHCAF, a crucial subunit of the Sin3 deacetylase complex (Sin3/HDAC), plays a pivotal role in the repression of genes encoding components of the TGF-beta signaling pathway. As a core component of the SIN3A complex in embryonic stem (ES) cells, SINHCAF collaborates with SIN3A, HDAC1, SAP30, RBBP4, OGT, and TET1. This complex is essential for maintaining the rapid proliferation potential of ES cells while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming. Moreover, SINHCAF promotes the stability of SIN3A and facilitates its presence on chromatin. It interacts with the Sin3/HDAC corepressor complex, which includes BRMS1, BRMS1L, ING2, SAP30, SAP30L, and HDAC1, emphasizing its involvement in intricate regulatory networks. Additionally, SINHCAF interacts directly with SIN3A and OGT, underscoring its integral role in the molecular interactions that govern gene expression and cellular processes in ES cells.

Human

E. coli

N-GST

Q9NP50 (M1-W221)

58516  [NCBI]

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

51.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.