SINHCAF Protein, Human (GST)
SINHCAF is a key subunit of the Sin3 deacetylase complex (Sin3/HDAC) and is essential for inhibiting genes related to the TGF-β signaling pathway. In embryonic stem (ES) cells, SINHCAF forms the SIN3A complex together with SIN3A, HDAC1, SAP30, RBBP4, OGT, and TET1. SINHCAF Protein, Human (GST) is the recombinant human-derived SINHCAF protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SINHCAF is a key subunit of the Sin3 deacetylase complex (Sin3/HDAC) and is essential for inhibiting genes related to the TGF-β signaling pathway. In embryonic stem (ES) cells, SINHCAF forms the SIN3A complex together with SIN3A, HDAC1, SAP30, RBBP4, OGT, and TET1. SINHCAF Protein, Human (GST) is the recombinant human-derived SINHCAF protein, expressed by E. coli , with N-GST labeled tag.
Background
SINHCAF, a crucial subunit of the Sin3 deacetylase complex (Sin3/HDAC), plays a pivotal role in the repression of genes encoding components of the TGF-beta signaling pathway. As a core component of the SIN3A complex in embryonic stem (ES) cells, SINHCAF collaborates with SIN3A, HDAC1, SAP30, RBBP4, OGT, and TET1. This complex is essential for maintaining the rapid proliferation potential of ES cells while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming. Moreover, SINHCAF promotes the stability of SIN3A and facilitates its presence on chromatin. It interacts with the Sin3/HDAC corepressor complex, which includes BRMS1, BRMS1L, ING2, SAP30, SAP30L, and HDAC1, emphasizing its involvement in intricate regulatory networks. Additionally, SINHCAF interacts directly with SIN3A and OGT, underscoring its integral role in the molecular interactions that govern gene expression and cellular processes in ES cells.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9NP50-1 (M1-W221)
-
Molecular Construction
-
N-term
-
GST
-
SINHCAF (M1-W221)
Accession # Q9NP50-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
SINHCAF; Tera Protein Homolog; Prev. C12orf14; Family With Sequence Similarity 60, Member A; Prev. FAM60A; Family With Sequence Similarity 60 Member A; TERA; Chromosome 12 Open Reading Frame 14; SIN3-HDAC Complex-Associated Factor; L4; SIN3-HDAC Complex A
-
AA Sequence
MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW
-
Predicted Molecular Mass
51.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
