Copy Link Print Information

SLITRK4 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

SLITRK4 Protein is pivotal in synaptogenesis, promoting synapse differentiation and synaptic maturation. Conversely, it suppresses neurite outgrowth, indicating a regulatory role in neuronal morphology. Interacting with PTPRD through its LRR 1 and 2 repeats, SLITRK4 suggests a potential role in modulating the activity or function of PTPRD, a receptor-type protein tyrosine phosphatase associated with neural development and synaptic plasticity. SLITRK4 Protein, Human (HEK293, His) is the recombinant human-derived SLITRK4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • SLITRK4 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

SLITRK4 Protein is pivotal in synaptogenesis, promoting synapse differentiation and synaptic maturation. Conversely, it suppresses neurite outgrowth, indicating a regulatory role in neuronal morphology. Interacting with PTPRD through its LRR 1 and 2 repeats, SLITRK4 suggests a potential role in modulating the activity or function of PTPRD, a receptor-type protein tyrosine phosphatase associated with neural development and synaptic plasticity. SLITRK4 Protein, Human (HEK293, His) is the recombinant human-derived SLITRK4 protein, expressed by HEK293 , with C-His labeled tag.

Background

SLITRK4 plays a crucial role in synaptogenesis, actively promoting the differentiation of synapses, as evidenced by its involvement in synaptic maturation. Conversely, SLITRK4 suppresses neurite outgrowth, indicating a regulatory function in neuronal morphology. The protein interacts with PTPRD through its LRR 1 and 2 repeats, suggesting a potential role in modulating the activity or function of PTPRD, a receptor-type protein tyrosine phosphatase known for its involvement in neural development and synaptic plasticity.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q8IW52 (D19-P616)

  • Gene ID
    139065  [NCBI]
  • Molecular Construction
    • N-term
    • SLITRK4 (D19-P616)
      Accession # Q8IW52
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    SLITRK4; SLIT And NTRK-Like Family, Member 4; SLIT And NTRK Like Family Member 4; Alternative Protein SLITRK4; SLIT And NTRK-Like Protein 4; Slit And Trk Like Gene 4; DKFZp547M2010

  • AA Sequence

    DSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLVTKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELIPKPLNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDVFHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEISAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKLWVEKLSDGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITFTTPLGPIRSPPGGPVP

  • Predicted Molecular Mass

    68.6 kDa

  • Molecular Weight

    Approximately 85 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • SLITRK4 Protein, Human (HEK293, His) Product Image
    1/16
  • SLITRK4 Protein, Human (HEK293, His) Product Image